Property Summary

NCBI Gene PubMed Count 107
PubMed Score 217.14
PubTator Score 191.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
interstitial lung disease -1.700 2.6e-02
posterior fossa group B ependymoma 1.400 2.4e-04
Barrett's esophagus 1.500 4.2e-02
esophageal adenocarcinoma 1.400 2.0e-02
psoriasis -2.300 1.9e-04
astrocytoma 1.200 2.2e-11
glioblastoma 2.800 1.3e-03
oligodendroglioma 1.200 2.6e-08
osteosarcoma -2.736 3.6e-06
chronic lymphosyte leukemia -1.100 2.0e-07
periodontitis 1.200 2.0e-25
medulloblastoma -1.300 2.4e-02
medulloblastoma, large-cell -2.900 4.8e-05
adrenocortical adenoma -1.284 2.3e-02
adrenocortical carcinoma -1.727 7.7e-04
primary pancreatic ductal adenocarcinoma 1.142 4.9e-03
non-small cell lung cancer -1.994 3.9e-22
intraductal papillary-mucinous adenoma (... 1.700 2.9e-03
Hydrolethalus syndrome 1.398 4.9e-02
lung cancer -3.400 7.6e-06
colon cancer -1.400 4.7e-02
Breast cancer -2.200 1.7e-10
interstitial cystitis 2.100 9.9e-04
cystic fibrosis -1.300 1.8e-03
lung adenocarcinoma -2.300 2.6e-12
pilocytic astrocytoma 1.100 2.5e-02
lung carcinoma -1.200 5.2e-15
breast carcinoma -1.100 7.6e-16
Pick disease 1.200 1.4e-03
gastric carcinoma 1.400 3.2e-02
ovarian cancer 2.200 3.1e-04

Gene RIF (72)

PMID Text
26351211 siRNA suppression of NEDD9 inhibits proliferation and enhances apoptosis in renal cell carcinoma.
26324022 NEDD9 has an essential role in development as well as in neoplastic cell proliferation, apoptosis, adhesion, migration and invasion. (Review)
26211595 Serum NEDD9 was elevated in gastric cancer patients and had an unfavorable prognostic effect.
26011298 The presence of the dna fragment in the NSCLC-N6-L16 cell ChIP assays demonstrated a physical link between NEDD9 and p53.
25967390 discuss emerging evidence supporting involvement of NEDD9 in additional pathological conditions, including stroke and polycystic kidney disease
25817040 BCAR3 is an essential interactor and mediator of HEF1-induced migration.
25646678 miR145 is inversely correlated with NEDD9 expression in pancreatic cancer tissues and restoration of miR145 in Panc1 cells reduced NEDD9 mRNA and protein expression accompanied by inhibition of cell proliferation, invasion and migration.
25577245 our findings suggest that NEDD9 acts as an oncogene and promotes GC metastasis via EMT.
25445787 NEDD9 expression in breast cancer cells enhances the expression of chondroitin sulfate glycosaminoglycans, particularly the CS-E subunit that enhances growth.
25319010 Study uncovers a new role of NEDD9 as a regulator of integrin trafficking through CAV1-dependent endocytosis, and provide new insight into the regulation of migration of breast cancer cells.
25241893 Results establish a novel role for NEDD9 as a key regulator of Arf6-dependent trafficking of MMP14 and its invasive properties, highlighting the basic mechanism utilized by NEDD9 to support breast cancer cell invasion and metastasis.
25051398 Knockdown of the NEDD9 gene results in suppression of lung adenocarcinoma cell proliferation, migration, invasion and cell growth in vitro and in vivo
24966970 Colorectal adenocarcinoma patients with a higher NEDD9 expression had a significantly shorter overall survival.
24906654 The expression of Nedd9 was upregulated in gastric cancer, high expression of Nedd9 significantly correlated with cancer progression and poor prognosis in gastric cancer.
24728978 NEDD9 regulates epithelial-mesenchmal transition and cell invasion in prostate cancer cells induced by TGF-beta.
24676793 Obtained data revealed remarkable increase in the expression levels of GHR and NEDD9 proteins in both epithelial and stromal components of axillary lymph node metastases in comparison with those of non-metastatic tumours.
24664584 NEDD9 may be used as a biomarker in the clinical setting to predict the prognosis of gastric cancer patients.
24663101 Depletion of the NEDD9 expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
24574519 NEDD9 binds to and regulates acetylation of CTTN in an Aurora A kinase (AURKA)/HDAC6-dependent manner.
24469954 NEDD9 overexpression correlates with the progression and prognosis in gastric carcinoma.
24439227 NEDD9 overexpression is an independent factor of poor prognosis and may serve as a potential biomarker in epithelial ovarian cancer
24337070 Data reveal that NEDD9 can regulate 3D migration speed independent of the Rac1 morphology switch.
24202705 Depletion of NEDD9 impaired invasion of cancer cells through inactivation of membrane-bound matrix metalloproteinase MMP14 by excess TIMP2 on the cell surface.
24174333 Data indicate that NEDD9 knockdown significantly inhibits migration, invasion and metastasis of lung cancer cells in vitro and in vivo.
24058594 NEDD9 promotes migration and invasion in cervical carcinoma cells, probably via a positive feedback loop of tyrosine phosphorylation between NEDD9 and FAK or SRC.
23355420 The findings indicate that HEF1 promotes EMT and bone invasion in prostate cancer by directly targeted by miR-145, and miR-145 suppresses EMT and invasion, at least in part, through repressing HEF1.
23247867 High NEDD9 expression is associated with pancreatic ductal adenocarcinoma.
23086683 The mean overall survival of NSCLC patients overexpressing NEDD9 (39.10 +/- 6.49 months) was markedly shorter.
23074285 In clinical specimens, elevated expression of NEDD9 was associated with malignant progression and metastasis.CRTC1-NEDD9 signaling axis mediates lung cancer progression caused by LKB1 loss.
23037767 Overexpression of NEDD9 promoted lung metastasis of an lung cancer cell line in transgenic mice.
22963925 The GG genotype of NEDD9 rs760678 polymorphism would be a protective factor for AD in Caucasians but not in Asians.[meta-analysis]
22869051 Results demonstrate the critical role of miR-145 and NEDD9 in regulating glioblastoma invasion and suggest a potential role of NEDD9 as a biomarker for glioma progression.
22810897 Abl family kinases modulate T cell-mediated inflammation and chemokine-induced migration through the adaptor HEF1 and the GTPase Rap1.
22732573 HEF1 may have a role in carcinogenesis of lung cancer; miRNA be a therapeutic target
22447485 NEDD9 is upregulated in lung adenocarcinoma, and overexpression of NEDD9 protein has been strongly correlated with staging and differentiation grade and tumor size in lung adenocarcinoma.
22328516 signalling through increased NEDD9 levels requires integrin beta3 signalling, which leads to elevated phosphorylation of integrin beta3
22061964 Data reveal that the tumour suppressor PP2A may act via S369 to regulated NEDD9-mediated cell spreading.
21765937 Cas proteins do not affect E-cadherin transcription, but rather, BCAR1 and NEDD9 signal through SRC to promote E-cadherin removal from the cell membrane and lysosomal degradation.
21399483 Polymorphism, rs760678, within NEDD9 gene is association with the risk of AD and cognitive performance in Chinese older persons
21317929 Data suggest that HEF1 may represent an attractive candidate for drug targeting in CRC.
21059344 NEDD9 polymorphism has a possible role in changing the genetic susceptibility to late-onset Alzheimer's disease in a Han Chinese population.
21059344 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20498643 HEF1 is required for VEGF-mediated Head and Neck Squamous Cell Carcinoma cell migration and invasion.
20430066 An implication of the NEDD9 allelic variant in late-onset AD, with an independent effect of the apolipoprotein E epsilon4 allele in the risk of developing AD.
20430066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20428794 B2 RNA seems especially interesting in that it can regulate apoptosis and cell proliferation by modulating HEF1.
20413850 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19648964 Nedd9/Hef1/Cas-L mediates the dioxin-elicited changes related to cell plasticity, including alterations of cellular adhesion and shape, cytoskeleton reorganization, and increased cell migration.
19539609 Phosphorylation of HEF1 on serine 369 induces its proteasomal degradation.
19417561 Overexpression of Cas-L is associated with imatinib-resistant gastrointestinal stromal tumor cells.
19275884 These results suggest that SHP-2 regulates tyrosine phosphorylation of Cas-L, hence opposing the effect of kinases, and SHP-2 is a negative regulator of cell migration mediated by Cas-L.
19103205 study presents a pluridisciplinary approach, including small-angle X-ray scattering, that provides first insights into the structure of the complex formed between breast cancer anti-oestrogen resistance 3 (BCAR3) and HEF1
18585997 NEDD9 is directly regulated by atRA through a complex retinoic acid response element (RARE) located in the NEDD9 proximal promoter and consisting of four conserved half-sites separated by 1, 5, and 1 intervening base pairs.
18579580 rs760678 SNP of the NEDD9 gene is a weak genetic determinant of Alzheimer's disease and Parkinson's disease .
18579580 Observational study of gene-disease association. (HuGE Navigator)
18465784 Cas-L is one of the targets of inflammatory cytokines and is also modulated by cell adhesion process in neutrophils
18063669 Evidence is presented that variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases.
18063669 Observational study of gene-disease association. (HuGE Navigator)
17908996 Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.
17703068 HEF1/NEDD9/Cas-L expression and function in signaling relevant to cell attachment, migration, invasion, cell cycle, apoptosis, and oncogenic signal transduction. Review.
17604723 Here, we show that interactions between the prometastatic scaffolding protein HEF1/Cas-L/NEDD9 and the oncogenic Aurora A (AurA) kinase at the basal body of cilia causes phosphorylation and activation of HDAC6, promoting ciliary disassembly.
16394104 HEF1 associates with the RhoA-GTP exchange factor ECT2, an orthologue of the Drosophila cytokinetic regulator Pebble, providing a direct means for HEF1 control of RhoA.
16352661 These results suggest that the adhesion-dependent actin organization regulates proteasomal turnover of HEF1 through the activity of PP2A.
16344118 HEF1-promoted processes actively extend from the cell body and resemble neurites both in the manner of process extension and in the distribution of adhesion-associated molecules.
16184168 The HEF1 protein overexpression of HEF1 causes an increase in centrosome numbers and multipolar spindles, resembling defects induced by manipulation of the mitotic regulatory kinase Aurora-A (AurA).
15592516 NEDD9 (Cas-L) binds human T-lymphotropic virus type I (HTLV-I) Tax and specifically regulates Tax-NF-kappaB pathway.
15376324 NEDD9 is regulated in neuroblastoma cells by all-trans retinoic acid.
15051726 Reults demonstrate the function of atrophin-1-interacting protein 4 as an ubiquitin E3 ligase for human enhancer of filamentation 1.
12847683 Cas-L plays an important role in the pathophysiology of rheumatoid arthritis
12189134 HEF1 expression is regulated by TGF-beta1 and HEF1 phosphorylation is dependent on cell adhesion and Src kinase activity

AA Sequence

MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQET      1 - 70
ASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQR     71 - 140
SIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKP    141 - 210
QGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYN    211 - 280
CDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH    281 - 350
NPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL    351 - 420
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQ    421 - 490
RVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPG    491 - 560
PGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGLSKEQAPDCSSSDGSERSWMDDYD    561 - 630
YVHLQGKEEFERQQKELLEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGV    631 - 700
SAQDRQLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQ    701 - 770
DIRNKVMNSSNQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF          771 - 834
//

Text Mined References (110)

PMID Year Title
26351211 2014 siRNA Suppression of NEDD9 Inhibits Proliferation and Enhances Apoptosis in Renal Cell Carcinoma.
26324022 2015 Roles of neural precursor cell expressed, developmentally downregulated 9 in tumor-associated cellular processes (Review).
26211595 2015 Serum neural precursor cell-expressed, developmentally down regulated 9 (NEDD9) level may have a prognostic role in patients with gastric cancer.
26011298 2015 TP53 transcription factor for the NEDD9/HEF1/Cas-L gene: potential targets in Non-Small Cell Lung Cancer treatment.
25967390 2015 Preclinical and clinical studies of the NEDD9 scaffold protein in cancer and other diseases.
25817040 2015 Human enhancer of filamentation 1-induced colorectal cancer cell migration: Role of serine phosphorylation and interaction with the breast cancer anti-estrogen resistance 3 protein.
25646678 2015 MicroRNA-145 suppresses cell proliferation, invasion and migration in pancreatic cancer cells by targeting NEDD9.
25577245 2015 Involvement of NEDD9 in the invasion and migration of gastric cancer.
25445787 2015 Role for chondroitin sulfate glycosaminoglycan in NEDD9-mediated breast cancer cell growth.
25416956 2014 A proteome-scale map of the human interactome network.
25319010 2015 Prometastatic NEDD9 Regulates Individual Cell Migration via Caveolin-1-Dependent Trafficking of Integrins.
25241893 2015 NEDD9/Arf6-dependent endocytic trafficking of matrix metalloproteinase 14: a novel mechanism for blocking mesenchymal cell invasion and metastasis of breast cancer.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
25051398 2014 Effects of lentivirus-mediated RNAi knockdown of NEDD9 on human lung adenocarcinoma cells in vitro and in vivo.
24966970 2014 High expression of NEDD9 predicts adverse outcomes of colorectal cancer patients.
24906654 2014 Overexpression of Nedd9 is a prognostic marker of human gastric cancer.
24728978 2014 NEDD9 crucially regulates TGF-?-triggered epithelial-mesenchymal transition and cell invasion in prostate cancer cells: involvement in cancer progressiveness.
24676793 2014 Expression of growth hormone receptor, plakoglobin and NEDD9 protein in association with tumour progression and metastasis in human breast cancer.
24664584 2014 NEDD9 overexpression correlates with poor prognosis in gastric cancer.
24574519 2014 NEDD9 regulates actin dynamics through cortactin deacetylation in an AURKA/HDAC6-dependent manner.
24469954 2014 NEDD9 overexpression correlates with the progression and prognosis in gastric carcinoma.
24439227 2014 NEDD9 overexpression is associated with the progression of and an unfavorable prognosis in epithelial ovarian cancer.
24337070 2014 NEDD9 regulates 3D migratory activity independent of the Rac1 morphology switch in glioma and neuroblastoma.
24202705 2014 NEDD9 depletion leads to MMP14 inactivation by TIMP2 and prevents invasion and metastasis.
24174333 2014 NEDD9 promotes lung cancer metastasis through epithelial-mesenchymal transition.
24058594 2013 The overexpression of scaffolding protein NEDD9 promotes migration and invasion in cervical cancer via tyrosine phosphorylated FAK and SRC.
23355420 2013 HEF1 promotes epithelial mesenchymal transition and bone invasion in prostate cancer under the regulation of microRNA-145.
23247867 2013 Expression of NEDD9 in pancreatic ductal adenocarcinoma and its clinical significance.
23086683 2013 Overexpression of NEDD9 is associated with altered expression of E-Cadherin, ?-Catenin and N-Cadherin and predictive of poor prognosis in non-small cell lung cancer.
23074285 2012 The CRTC1-NEDD9 signaling axis mediates lung cancer progression caused by LKB1 loss.
23037767 2012 Impact of the integrin signaling adaptor protein NEDD9 on prognosis and metastatic behavior of human lung cancer.
22963925 2012 NEDD9 rs760678 polymorphism and the risk of Alzheimer's disease: a meta-analysis.
22869051 2012 NEDD9, a novel target of miR-145, increases the invasiveness of glioblastoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22810897 2012 Abl family kinases modulate T cell-mediated inflammation and chemokine-induced migration through the adaptor HEF1 and the GTPase Rap1.
22732573 2012 miRNAs, a potential target in the treatment of Non-Small-Cell Lung Carcinomas.
22447485 2012 Expression and clinical significance of NEDD9 in lung tissues.
22328516 2012 The metastasis gene NEDD9 product acts through integrin ?3 and Src to promote mesenchymal motility and inhibit amoeboid motility.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
22061964 2012 PP2A phosphatase suppresses function of the mesenchymal invasion regulator NEDD9.
21829474 2011 NEDD9 is a positive regulator of epithelial-mesenchymal transition and promotes invasion in aggressive breast cancer.
21765937 2011 NEDD9 and BCAR1 negatively regulate E-cadherin membrane localization, and promote E-cadherin degradation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21399483 NEDD9 gene polymorphism influences the risk of Alzheimer disease and cognitive function in Chinese older persons.
21317929 2011 HEF1, a novel target of Wnt signaling, promotes colonic cell migration and cancer progression.
21145356 2011 Estradiol stabilizes the 105-kDa phospho-form of the adhesion docking protein NEDD9 and suppresses NEDD9-dependent cell spreading in breast cancer cells.
21059344 2011 NEDD9 is genetically associated with Alzheimer's disease in a Han Chinese population.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20498643 2010 Regulation of invasive behavior by vascular endothelial growth factor is HEF1-dependent.
20430066 2010 Different implication of NEDD9 genetic variant in early and late-onset Alzheimer's disease.
20428794 2010 A novel large regulator RNA, B2, partially overlaps the HEF1/NEDD9/Cas-L gene.
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068165 2010 HEF1 is a crucial mediator of the proliferative effects of prostaglandin E(2) on colon cancer cells.
19648964 2009 Nedd9/Hef1/Cas-L mediates the effects of environmental pollutants on cell migration and plasticity.
19539609 2009 Phosphorylation of human enhancer of filamentation (HEF1) on serine 369 induces its proteasomal degradation.
19417561 2009 Cas-L was overexpressed in imatinib-resistant gastrointestinal stromal tumor cells.
19275884 2009 SHP-2 inhibits tyrosine phosphorylation of Cas-L and regulates cell migration.
19103205 2009 Structural insights into the association between BCAR3 and Cas family members, an atypical complex implicated in anti-oestrogen resistance.
18984162 2008 Rac activation and inactivation control plasticity of tumor cell movement.
18585997 2008 atRA Regulation of NEDD9, a gene involved in neurite outgrowth and cell adhesion.
18579580 2008 Association study of the NEDD9 gene with the risk of developing Alzheimer's and Parkinson's disease.
18465784 2008 Expression and tyrosine phosphorylation of Crk-associated substrate lymphocyte type (Cas-L) protein in human neutrophils.
18063669 2008 Evidence that common variation in NEDD9 is associated with susceptibility to late-onset Alzheimer's and Parkinson's disease.
17908996 2007 A new central scaffold for metastasis: parsing HEF1/Cas-L/NEDD9.
17703068 2007 Molecular basis for HEF1/NEDD9/Cas-L action as a multifunctional co-ordinator of invasion, apoptosis and cell cycle.
17604723 2007 HEF1-dependent Aurora A activation induces disassembly of the primary cilium.
16394104 2006 Deregulation of HEF1 impairs M-phase progression by disrupting the RhoA activation cycle.
16352661 2006 Cell adhesion regulates Ser/Thr phosphorylation and proteasomal degradation of HEF1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16344118 2005 The Cas family docking protein, HEF1, promotes the formation of neurite-like membrane extensions.
16184168 2005 The focal adhesion scaffolding protein HEF1 regulates activation of the Aurora-A and Nek2 kinases at the centrosome.
15592516 2005 HTLV-I Tax induces and associates with Crk-associated substrate lymphocyte type (Cas-L).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15376324 2004 Crk-associated substrate (Cas) family member, NEDD9, is regulated in human neuroblastoma cells and in the embryonic hindbrain by all-trans retinoic acid.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15144564 2004 Direct interaction between Smad3, APC10, CDH1 and HEF1 in proteasomal degradation of HEF1.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15051726 2004 Atrophin-1-interacting protein 4/human Itch is a ubiquitin E3 ligase for human enhancer of filamentation 1 in transforming growth factor-beta signaling pathways.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12847683 2003 Role of Crk-associated substrate lymphocyte type in the pathophysiology of rheumatoid arthritis in tax transgenic mice and in humans.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12517963 2003 The GDP exchange factor AND-34 is expressed in B cells, associates with HEF1, and activates Cdc42.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12189134 2002 Regulation of HEF1 expression and phosphorylation by TGF-beta 1 and cell adhesion.
11827972 2002 MICAL, a novel CasL interacting molecule, associates with vimentin.
11782456 2002 Members of the Zyxin family of LIM proteins interact with members of the p130Cas family of signal transducers.
11438665 2001 Proteolysis of the docking protein HEF1 and implications for focal adhesion dynamics.
11118211 2000 A novel ability of Smad3 to regulate proteasomal degradation of a Cas family member HEF1.
11054566 2000 Evidence that dim1 associates with proteins involved in pre-mRNA splicing, and delineation of residues essential for dim1 interactions with hnRNP F and Npw38/PQBP-1.
10866674 2000 The docking protein HEF1 is an apoptotic mediator at focal adhesion sites.
10808124 2000 Beta 1-integrin-mediated cell signaling in T lymphocytes.
10692442 2000 Chat, a Cas/HEF1-associated adaptor protein that integrates multiple signaling pathways.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10502414 1999 Dimerization of the docking/adaptor protein HEF1 via a carboxy-terminal helix-loop-helix domain.
10490968 1999 Tyrosine phosphorylation of Crk-associated substrate lymphocyte-type is a critical element in TCR- and beta 1 integrin-induced T lymphocyte migration.
10455189 1999 Cytoskeleton-dependent tyrosine phosphorylation of the p130(Cas) family member HEF1 downstream of the G protein-coupled calcitonin receptor. Calcitonin induces the association of HEF1, paxillin, and focal adhesion kinase.
9820532 1998 Differential interaction of Crkl with Cbl or C3G, Hef-1, and gamma subunit immunoreceptor tyrosine-based activation motif in signaling of myeloid high affinity Fc receptor for IgG (Fc gamma RI).
9748319 1998 Combination of gene targeting and substrate trapping to identify substrates of protein tyrosine phosphatases using PTP-PEST as a model.
9584194 1998 Cell cycle-regulated processing of HEF1 to multiple protein forms differentially targeted to multiple subcellular compartments.
9498705 1997 Association of the Cas-like molecule HEF1 with CrkL following integrin and antigen receptor signaling in human B-cells: potential relevance to neoplastic lymphohematopoietic cells.
9497377 1998 T cell receptor-mediated tyrosine phosphorylation of Cas-L, a 105-kDa Crk-associated substrate-related protein, and its association of Crk and C3G.
9405482 1997 BCR/ABL-induced leukemogenesis causes phosphorylation of Hef1 and its association with Crkl.
9366405 1997 Alpha 4 beta 1 integrin-mediated tyrosine phosphorylation in human T cells: characterization of Crk- and Fyn-associated substrates (pp105, pp115, and human enhancer of filamentation-1) and integrin-dependent activation of p59fyn1.
9360983 1997 Tyrosine phosphorylation of Crk-associated substrates by focal adhesion kinase. A putative mechanism for the integrin-mediated tyrosine phosphorylation of Crk-associated substrates.
9020138 1997 Involvement of p130(Cas) and p105(HEF1), a novel Cas-like docking protein, in a cytoskeleton-dependent signaling pathway initiated by ligation of integrin or antigen receptor on human B cells.
8879209 1996 Structure and function of Cas-L, a 105-kD Crk-associated substrate-related protein that is involved in beta 1 integrin-mediated signaling in lymphocytes.
8668148 1996 Human enhancer of filamentation 1, a novel p130cas-like docking protein, associates with focal adhesion kinase and induces pseudohyphal growth in Saccharomyces cerevisiae.