Property Summary

Ligand Count 1
NCBI Gene PubMed Count 23
PubMed Score 23.60
PubTator Score 16.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Leigh disease 100 5.185 2.6
Osteoarthritis 184 0.0 0.0
Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 3.545 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 2.300 8.2e-03
ependymoma 2.400 7.8e-03
intraductal papillary-mucinous carcinoma... 1.200 5.0e-03
lung adenocarcinoma 1.300 1.8e-08
Multiple myeloma 1.205 3.6e-03
non primary Sjogren syndrome sicca 1.300 3.3e-02
oligodendroglioma 2.400 3.8e-03
osteosarcoma 1.390 9.2e-05
ovarian cancer -1.200 5.8e-03
pancreatic ductal adenocarcinoma liver m... 1.558 1.3e-02
Pick disease 1.200 6.3e-07

Gene RIF (7)

AA Sequence

MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGM      1 - 70
TLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRT     71 - 140
TRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR    141 - 210
//

Text Mined References (25)

PMID Year Title