Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.02
PubTator Score 126.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.147 1.2e-02
ovarian cancer 1.500 8.2e-06
tuberculosis 1.400 7.6e-08

Gene RIF (7)

AA Sequence

MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCK      1 - 70
RDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL        71 - 137
//

Text Mined References (19)

PMID Year Title