Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.67
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma 702 9.4e-03

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma -1.200 9.4e-03

Synonym

Accession A1L188
Symbols C17orf89

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSANGAVWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFEALRSCFAAAAKKTL      1 - 70
EGGC                                                                       71 - 74
//

Text Mined References (4)

PMID Year Title