Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.37
PubTator Score 5.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 5.2e-04
astrocytic glioma -1.500 2.8e-02
atypical teratoid / rhabdoid tumor -1.300 2.1e-04
ependymoma -1.100 1.9e-06
glioblastoma -1.200 8.5e-04
hereditary spastic paraplegia -1.113 5.1e-03
ovarian cancer 1.400 1.3e-05
pancreatic ductal adenocarcinoma liver m... -1.173 1.9e-02
Pick disease -1.100 3.3e-04

Gene RIF (5)

AA Sequence

MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAARQPEPTKFDY      1 - 70
LKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADIAENALKNSSETEIPTVSVLA     71 - 140
DEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKPDGVFIGAMFGGDTLYELRCSLQLAETEREG    141 - 210
GFSPHISPFTAVNDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTML    211 - 280
AAAAVYREMYRNEDGSVPATYQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ         281 - 345
//

Text Mined References (14)

PMID Year Title