Property Summary

NCBI Gene PubMed Count 24
PubMed Score 6.43
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.100 3.7e-03
tuberculosis and treatment for 6 months 1.300 2.8e-03
group 4 medulloblastoma 1.200 2.6e-02
aldosterone-producing adenoma -1.020 1.4e-02
subependymal giant cell astrocytoma -1.537 3.3e-03
Pick disease -1.400 2.8e-07
ovarian cancer 2.000 4.0e-05

Gene RIF (7)

PMID Text
22461910 NDUFA10 was found to be differentially methylated and expressed in human squamous cell carcinomas.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10 (NDUFA10) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGK      1 - 70
GKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRL     71 - 140
LQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP    141 - 210
VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDK    211 - 280
GPWLKQDNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDK    281 - 350
WIWLK                                                                     351 - 355
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25412178 2014 The complex I subunit NDUFA10 selectively rescues Drosophila pink1 mutants through a mechanism independent of mitophagy.
24652937 2014 PINK1 loss-of-function mutations affect mitochondrial complex I activity via NdufA10 ubiquinone uncoupling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23910658 2013 Identification of regions associated with variation in sensitivity to food-related odors in the human genome.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21150889 2011 NDUFA10 mutations cause complex I deficiency in a patient with Leigh disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18442173 2008 Mass spectrometric characterization of mitochondrial complex I NDUFA10 variants.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10330338 1999 Human mitochondrial complex I in health and disease.
9878551 1998 cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.
8486360 1993 Construction and evaluation of a hncDNA library of human 12p transcribed sequences derived from a somatic cell hybrid.
8088812 1994 Assignment of the gene for the human proliferating cell nucleolar protein P120 (NOL1) to chromosome 12p13 by fluorescence in situ hybridization and polymerase chain reaction with somatic cell hybrids.