Property Summary

NCBI Gene PubMed Count 236
PubMed Score 456.95
PubTator Score 296.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
chronic lymphocytic leukemia 1.452 9.4e-03
malignant mesothelioma -1.400 1.8e-06
astrocytic glioma 1.300 4.8e-03
ependymoma 1.200 1.6e-02
oligodendroglioma 1.100 1.2e-02
psoriasis 1.900 8.3e-05
osteosarcoma -2.434 6.7e-09
atypical teratoid / rhabdoid tumor 1.400 9.8e-07
glioblastoma 1.300 6.4e-05
medulloblastoma, large-cell 1.400 3.7e-06
primitive neuroectodermal tumor 1.500 1.9e-06
Crohn's disease -1.381 3.2e-03
ulcerative colitis -1.600 9.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 1.5e-02
lung cancer -1.300 3.6e-04
non primary Sjogren syndrome sicca -1.200 1.3e-02
spina bifida -1.171 4.3e-02
Pick disease 1.600 2.5e-05
ovarian cancer 1.900 6.2e-05

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
731 screening 519 / 0 / 195737 Primary biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1048 other 390 / 0 / 98977 Measurement of TR-FRET detection format artefact in the screen for agonists of steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1301 screening 230 / 0 / 564 Confirmation biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1331 confirmatory 6 / 0 / 343 Dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1684 confirmatory 11 / 0 / 389 TR-FRET dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma): non-selective agonists
1812 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma)
588352 screening 621 / 0 / 358863 Luminescence-based cell-based primary high throughput screening assay to identify inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
588357 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
588792 screening 864 / 0 / 1437 Luminescence-based cell-based high throughput confirmation assay for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
602166 confirmatory 119 / 0 / 110 Luminescence-based cell-based high throughput dose response assay for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
More...

Gene RIF (188)

PMID Text
26833126 The transcriptional coactivator SRC-3.
26449542 NCOA3 polymorphisms might influence the risk of dyslipidemia and serum lipid levels in Chinese Han population.
26369632 Total SRC3 is selectively found at enhancer regions.
26345978 The aim of this study was to investigate the expression of AIB1 in human esophageal squamous cell carcinoma and its correlation with Ki67 expression.
26267537 Data suggest that over-stimulating the steroid seceptor coactivators SRC-1, SRC-2, and SRC-3 oncogenic program can be an effective strategy to kill cancer cells.
26211391 NCOA3 is subject to a cis-acting expression quantitative trait locus in articular cartilage, which correlates with the osteoarthritis association signal and with the OA-associated allele of the SNP rs116855380, which is located 10.3 kb upstream of NCOA3.
26066330 miR-137 has a role in targeting p160 steroid receptor coactivators SRC1, SRC2, and SRC3 and inhibits cell proliferation
25970779 AIB1 promotes gastric cancer cell proliferation, survival and invasiveness through modulating major signaling pathways such as ErbB and Wnt/beta-catenin pathways. Findings suggest that AIB1 plays an important role in the pathogenesis of gastric cancer.
25859975 we describe a TR-FRET assay that monitors the interaction of the estrogen receptor (ER) alpha ligand binding domain (labeled with a terbium chelate via a streptavidin-biotin interaction) with a sequence of coactivator protein SRC3
25728767 ER-alpha, SRC-3, and p300 form an active protein complex on estrogen response element-DNA.
25531332 NCOA3 upregulates mucin 1 and 4 via transcriptional and post-translational changes in pancreatic cancer.
25263716 There is a significant effect of AIB1 genetic variation on ovarian cancer risk, and AIB1 underlies the development of ovarian cancer.
25263446 AIB1 promotes colorectal cancer progression at least in part through enhancing Notch signaling.
24875297 Our study clearly demonstrated differentiation-dependant expression of SRC-1 and SRC-3 in chondrosarcoma
24788909 Results show that CCT-mediated AIB1 folding appears to be involved in the rigidity response of breast cancer cells, which provides novel insight into the mechanisms of bone metastasis.
24743578 verrucarin A is a potent and selective SMI that blocks SRC-3 function through an indirect mechanism.
24740565 we found that MicroRNA-195 (miR-195) could negatively regulate protein levels of SRC-3 through targeting its 3'-untranslated region (3'-UTR) in hepatocellular carcinoma (HCC) cells
24680642 Results indicate a combination of decreased expression of ERs, AR and SRC-3 but not SRC-1 may be involved in the tumorigenesis of gliomas, ERalpha/SRC-3 axis may play central role in the regulation these tumors.
24678732 AIB1, AIB1-delta4 and ANCO1 are important determinants of endocrine and growth factor responsiveness in breast cancer.
24585635 ERK3 regulates endothelial cell migration, proliferation and tube formation by upregulating SRC-3/SP-1-mediated VEGFR2 expression.
24584933 overexpression of SRC-3 promoted glycolysis in bladder cancer cells through HIF1alpha to facilitate tumorigenesis, which may be an intriguing drug target for bladder cancer therapy.
24390736 Bufalin as a potent small-molecule inhibitor for SRC-3 and SRC-1.
24304549 NCOA3 is a selective co-activator of estrogen receptor alpha-mediated transactivation of PLAC1.
24282087 demonstrated that SRC-3 up-regulated FoxM1 expression through co-activation of C/EBPgamma
24134957 The above results clearly demonstrated a high frequency of overexpression of SRC-3 immunoreactivities in different bone cancers, indicating its potential roles in the prognosis and treatment of these cancers.
23886194 Up-regulation of SRC-3 is associated with bladder cancer.
23851504 Results propose that increased expression of AIB1, through the maintenance of breast cancer-initiating cell, facilitates formation of ductal carcinoma in situ, a necessary step before development of invasive disease
23774759 Estrogen receptors alpha and beta and their key coregulators, SRC3 and RIP140, generate overlapping as well as unique chromatin-binding and transcription-regulating modules.
23762395 AIB1 exerted its effect on epithelial mesenchymal transition through its interaction with ERalpha, which could directly bind to the ERalpha-binding site on the SNAI1 promoter.
23670096 Our results suggest that high AIB1 is a predictive marker of good response to tamoxifen treatment in postmenopausal women and a prognostic marker of decreased recurrence-free survival in systemically untreated patients.
23660594 FoxG1 can function as a pro-apoptotic factor in part through suppression of AIB1 coactivator transcription complex formation, thereby reducing the expression of the AIB1 oncogene.
23652306 SRC-3 is a poor prognostic factor in epithelial ovarian cancers and appears to identify a population of patients who would benefit from the addition of taxanes to their chemotherapy regimen, due to resistance to platinum therapy.
23650284 Prostate cancer patients with high SRC-3 and undetectable PTEN exhibit decreased recurrence-free survival.
23606350 Up-regulation of nuclear receptor coactivator amplified in breast cancer-1 in papillary thyroid carcinoma correlates with lymph node metastasis.
23514585 PTEN might act as a negative regulator of AIB1 whereby the association of PTEN with both AIB1 and Fbw7alpha could lead to the downregulation of AIB1 transcriptional activity.
23511556 Results suggest that AIB1 promotes BC cell proliferation through the AKT pathway and E2F1. Furthermore, AIB1 overexpression predicts tumour progression in patients with non-muscle-invasive BC.
23483928 Genotypes of AIB1 polyglutamine polymorphism analyzed do not appear to be associated to a modified risk of breast cancer development in BRCA1 and BRCA2 mutation carriers.
23433587 Thus, our results demonstrate for the first time that AIB1 is expressed in prolactinomas and suggest its participation in the regulation of proliferation and apoptosis of tumoral cells.
23322234 our data show a strong relationship of AIB1 expression with poor prognosis and unfavorable tumor phenotype in breast cancer patients.
23230135 study confirm AIB1 to be a negative prognostic factor in an independent cohort of lymph-node-negative premenopausal breast cancer patients
22759465 These findings suggest that TNFalpha-mediated repression of SRC3 contributes to alveolar macrophage cathelicidin deficiency in severe sarcoidosis despite healthy vitD3 levels.
22627138 The HBx-AIB1 interaction was important for the activation of NFkappaB signal transduction, the HBx mutant that did not interact with AIB1showed dramatically lower NFkappaB activation activity than the WT HBx.
22560224 Results show Steroid Receptor Coactivator-3 (SRC-3) plays a central role in long chain fatty acid metabolism by directly regulating carnitine/acyl-carnitine translocase (CACT) gene expression.
22550166 study establishes a role for AIB1 in aromatase inhibitor-resistant breast cancer and describes a new mechanism of ER-alpha/AIB1 gene regulation which could contribute to the development of an aggressive tumor phenotype
22505454 A previously unknown role for ERK3 in promoting lung cancer cell invasiveness by phosphorylating SRC-3 and regulating SRC-3 proinvasive activity by site-specific phosphorylation.
22430150 The steroid receptor coactivator 3 regulates expression of macrophage migration inhibitory factor at the transcriptional level as demonstrated by reduced Mif mRNA in cells derived from SRC-3-null mutant mice.
22371647 Data show that sporadic colorectal cancers exhibit different mechanisms of NCOA3 regulation.
22370642 The overexpression of RAC3/AIB-1/steroid receptor coactivator-3 induced heme oxygenase-1 (HO-1).
22342158 A previously unknown function of SRC-3 in the control of endothelial cell phenotypes in vitro and neogenesis and physiologic wound healing in vivo is shown.
22307791 An AIB1 single nucleotide polymorphism revealed a significant protective effect for the Q586H variant in breast cancer. [Meta-analysis]
22283414 PIAS1 promotes SUMOylation of AIB1 and represses its transcriptional activity.
22213475 AIB1 plays an important role in proliferation and chemoresistance of cholangiocarcinoma through simultaneous activation of Akt and Nrf2 pathways.
22163316 Phosphorylation of AIB1 at mitosis is regulated by CDK1/CYCLIN B
22147914 Cullin 3 mediates SRC-3 ubiquitination and degradation to control the retinoic acid response
22142990 Results demonstrate that estradiol induces growth of human astrocytoma cell lines through ERalpha and its interaction with SRC-1 and SRC-3 and also suggest differential roles of ERalpha on cell growth depending on astrocytoma grade.
22052107 AIB1 is independently associated with poor prognosis of hepatocellular carcinoma.
22035181 High AIB1 is associated with breast cancer.
22002538 Average expression from SRC3-unique proximal genes correlated with recurrence-free survival for both estradiol-upregulated and -downregulated genes in cohorts of breast cancer patients.
21914189 both 53BP1 and SRC3 have a common function that converge at the BRCA1 promoter and possibly other genes important for DNA repair and genomic stability
21871888 Results reveal DRO1 as an AIB1-targeted tumor suppressor, providing a novel mechanism for AIB1-dependent inhibition of apoptosis.
21735116 Univariate survival analysis revealed that high AIB1 expression was associated with worse prognosis in astrocytic brain tumors
21636853 a model whereby the transcriptional activity of AIB1 is squelched by a repressive mechanism utilizing the N-terminal domain and that the increased coactivator function of AIB1-Delta4 is due to the loss of this inhibitory domain
21601620 The influence of the two NCOA3 variants on breast cancer risk by genotyping an Australian case-control study population, was investigated.
21577200 SPOP expression inhibited SRC-3-mediated oncogenic signaling and tumorigenesis.
21454665 The increase of NCOA3 is essential for SYT-SSX1-mediated synovial sarcoma formation. SYT-SSX1 does so by increasing the sumoylation of NCOA3 through interaction with a SUMO E3 ligase, PIASy, as well as the sumoylation of NEMO.
21220509 SRC-2 and SRC-3 concomitantly promote human adipocyte differentiation by attenuating phospho-PPARgamma-Serine114 and modulating PPARgamma cellular heterogeneity.
21184786 crucial role for SRC-3 in regulating hepatic lipid metabolism
21059860 Distinctive functions of p160 steroid receptor coactivators in proliferation of an estrogen-independent, tamoxifen-resistant breast cancer cell line.
21047772 HOXC8 blocks the AR-dependent recruitment of the steroid receptor coactivators steroid receptor coactivator-3 (SRC-3)
20852035 results demonstrate a high frequency of SRC-3 overexpression in non-small cell lung cancer (NSCLC) with a gender difference, suggesting that there is a specific role for SRC-3 in the pathogenesis of NSCLC
20663904 Small interfering RNA-mediated downregulation of SRC-3 in high-expressing, but not in low-expressing, lung cancer cells significantly inhibited tumor cell growth and induced apoptosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20422428 results confirm that AIB1 poly-Q repeat length polymorphism does not influence the BC risk in general but suggest that the specific AIB1 genotypes should be considered in patients with BC carrying mutation in the BRCA1/2 genes.
20422428 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20392877 These data link the SMRT corepressor directly with SRC family coactivators in positive regulation of ERalpha-dependent gene expression.
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20332317 Increased coactivator mRNA levels seem to be an early response to tamoxifen without dose-response relationship in the 1- to 20-mg range.
20305690 AIB1 is a master regulator of human hepatocellular carcinoma (HCC) growth and might be a useful molecular target for HCC prognosis and treatment.
20181721 Data give strong evidence to support the idea that the interpretative power of SRC-3 in estrogen signaling is mediated through the formation of distinct, cell state-dependent protein complexes.
20180986 Observational study of gene-disease association. (HuGE Navigator)
20159552 SRC-3Delta4, a splicing isoform of the SRC-3 oncogene, is a signaling adaptor that links EGFR and FAK and promotes EGF-induced phosphorylations of FAK and c-Src.
20155818 SRC-3 deficiency attenuated the disease severity of EAE through PPAR- upregulation, which induce an alternative activation state of microglia.
20137343 SRC-3 protein and mRNA expression levels were significantly downregulated in A549 cells induced by gambogic acid.
20124470 One mechanism of ACTR overexpression in cancer is the concerted function of nuclear coregulators ANCCA and ACTR; they point to therapeutic strategies that target the Rb-E2F axis and/or the coregulator ANCCA for ACTR-overexpressing cancers.
20086010 SRC3/AIB1 is a preferred coactivator for hormone-activated androgen receptor
20064830 Overexpression of AIB1 might provide a selective advantage for lymph node metastasis of lung ADC and serve as a useful biomarker for poor prognosis for NSCLC patients
20003447 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19884766 Nuclear receptor coactivator 3 (NCOA3) is downregulated in HIV-1 Tat and NC cotransfection of HEK 293T cells
19716257 SRC-3 appears to be implicated in the possible risk of developing prostate and ovarian cancer. Its presence appears to be a marker of aggressive disease.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19652917 the TDG-NCoA-3 interaction is important for broad range activation of steroid hormone nuclear receptors
19628566 High AIB1 is an independent predictive factor of improved response to tamoxifen.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19552757 Overexpression of AIB1 is associated with resistance to chemoradiotherapy in primary esophageal squamous cell carcinoma.
19491275 ERRalpha/AIB1 complexes may control estradiol-regulated genes in a hormone-independent manner
19470168 Observational study of gene-disease association. (HuGE Navigator)
19460752 Nuclear receptor coactivator 3 (NCOA3) is downregulated in HIV-1 Tat and NC cotransfection of HEK 293T cells
19460752 Knockdown of nuclear receptor coactivator 3 (NCOA3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19453261 Observational study of gene-disease association. (HuGE Navigator)
19433130 These results suggest that gambogic acid might exhibit its strong antitumor effects via the interruption of SRC-3.
19285025 These results suggest that the AIB1 protein could be a limiting factor in the HER1/HER2-mediated hormone-independent growth of tamoxifen resistance in breast cancer cells.
19277704 ERbeta1-dependent (genomic and non-genomic) and ER-coregulator-dependent (AIB-1, TIF-2) signal transductions in myofibroblasts may be involved in the initiation and progression of colorectal carcinomas.
19255064 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19198856 ER beta, AIB1, and TIF2 appear to be involved in colorectal tumorigenesis and might have prognostic significance.
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19144644 SUG-1 has a unique role in linking the transcription and degradation processes via its ability to interact with SRC-3.
19102007 role of AIB1 in oestrogen receptor -growth factor interactions.
19095746 The small interfering RNA depletion of SRC-3 inhibited growth of MCF-7 cells, and this was reflected in decreased cell cycle progression and increased apoptosis as well as a reduction in ERalpha transcriptional activity.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19052561 VDR and coactivators SRC2 and SRC3, which are also involved in other nuclear receptors as well, are critical for epidermis-specific sphingolipid production and barrier formation
18922467 The phosphatases PDXP, PP1, and PP2A were identified to be key negative regulators of SRC-3 transcriptional coregulatory activity in steroid receptor signalings.
18845648 important role for androgen receptor-associated coactivators in urothelial carcinoma of the bladder
18827493 AIB1 is frequently overexpressed in human breast cancer and has been shown to be associated with tamoxifen resistance
18765637 These results demonstrate regulated tyrosine phosphorylation of AIB1/SRC-3 at a C-terminal tyrosine residue (Y1357) that is phosphorylated after insulin-like growth factor 1, epidermal growth factor, or estrogen treatment of breast cancer cells.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18644862 In 560 human breast tumors, AIB1 expression was found to be positively associated with PEA3, MMP2, and MMP9
18636124 Observational study of gene-disease association. (HuGE Navigator)
18593949 SRC-3/AIB1 plays an essential role in prostate cancer cell invasion and metastasis.
18593948 Dysregulation of nuclear shuttling and proteasomal degradation may modulate the oncogenic potential of AIB1.
18521745 AIB1 may be critical in breast carcinogenesis
18426732 overexpression of AIB1 in nasopharyngeal carcinoma may be important in the acquisition of an invasive and/or metastatic phenotype.
18385039 Precise control of the cellular concentration of SRC-3 may thus serve as a mechanism for defining growth responses to estrogen receptors and other growth-promoting transcription factors
18313384 Results show that protein kinase C zeta phosphorylates and specifically stabilizes SRC-3 in a selective ER-dependent manner.
18246597 AIB1 with an increased UC (Urothelial Carcinoma) labeling index of Ki-67 was observed. AIB1 is an independent molecular marker for poor prognosis (shortened survival time) of patients with Urothelial Carcinoma.
18162290 ACTR functions as a coactivator of AP-1 to up-regulate the expression of matrix metalloproteinases such as MMP-7 and MMP-10 and reduce cell adhesion to specific extracellular matrix proteins.
17968310 RAC3 has been found associated with a protein complex containing AIF, Hsp90 and dynein, suggesting a role for the co-activator in the cytoplasmatic nuclear transport of these proteins associated with cytoskeleton
17927986 RAC3 is required for TRAIL resistance and this anti-apoptotic function is independent of its role in hormone receptor signaling.
17805331 MYST3-NCOA3 gene fusions were found in AML-M5. The breakpoint in NCOA3 is at bases 2752 & 2376 in the MYST3-NCOA3 & NCOA3-MYST3 fusion transcripts, respectively. The CREB-interacting domain is conserved.
17646391 Results indicate that phosphorylation coordinates SRC-3 coactivator function by linking the probabilistic formation of transient nuclear receptor-coactivator complexes with its molecular dynamics and cellular compartmentalization.
17636398 AIB1 was associated to disease-free survival for breast cancer patients treated with 2 years of adjuvant tamoxifen.
17574025 ubiquitination of SRC-3 is a phospho-mediated biphasic event and a transition from multi-(mono)ubiquitination (SRC-3 activation) to long-chain polyubiquitination (SRC-3 degradation) is processive during the coactivation of select transcription factors
17532621 SRC-3 might be an important indicator of uterine endometrial cancer advancement and survival.
17441340 The overexpression of AIB1 may play a role in the carcinogenesis and development of gynecological cancers, especially ovarian cancers.
17360478 the SRC3-myocardin interaction is a site of convergence for nuclear hormone receptor-mediated and VSMC-specific gene regulation
17223341 Both DRIP205 and SRC-3 are required for the keratinocyte differentiation
17043108 p/CIP/SRC-3 activity and stability are regulated by CARM1-dependent methylation
17008696 nuclear receptor coactivator-3 has a role in primary cutaneous melanoma
16951183 Serum withdrawal or growth in high cell density caused rapid degradation of AIB1 protein, but not mRNA, in immortalized breast cancer cell lines.
16940181 Data show that downregulation of AIB1 by Mir-17-5p resulted in decreased estrogen receptor-mediated, as well as estrogen receptor-independent, gene expression and decreased proliferation of breast cancer cells.
16923966 Results suggest that members of the SRC coactivator family, such as SRC-3, serve as substrates for the enzymatic coactivator coactivator-associated arginine methyltransferase 1 (CARM1).
16921507 androgen receptor and ACTR may play important roles in androgen ablation resistance by controlling key cell cycle gene expression
16916939 There is a positive feedback regulatory loop consisting of E2F1 and SRC-3 to maintain high levels of SRC-3 and E2F1 activity, which may partially interpret the oncogenic role of SRC-3 overexpression.
16760465 estrogen treatment led to increased phosphorylation and decreased sumoylation of AIB1; sumoylation coordinated with phosphorylation in regulating the transcriptional activity of AIB1
16670003 poly Q encoding region of AIB1 gene is somatic unstable in breast cancer cell line
16648476 ACTR has direct control of cell cycle gene expression; its autoregulation underlies its transforming activities.
16458427 Findings suggest a potential role of SRC-3 in the control of esophageal squamous cell carcinomas (ESCC) cell proliferation; such may be responsible, at least in part, for tumorigenesis and/or progression of ESCC.
16434590 Observational study of genotype prevalence. (HuGE Navigator)
16434590 the AIB1 glutamine repeat does not substantially modify risk of breast cancer in BRCA1 and BRCA2 mutation carriers
16365010 Observational study of gene-disease association. (HuGE Navigator)
16298470 These studies reveal a novel role for SRC-3 in ovarian cancer progression by promoting cell migration, independently of its role in estrogen receptor signaling.
16263829 Observational study of gene-disease association. (HuGE Navigator)
16263829 allelic variation at the NCOA3 locus may contribute to the genetic control of androgenic hormone and IGF levels and vertebral bone mass among older men
16244359 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16244359 Since AIB1 appears to modulate effect of endogenous hormones via the estrogen receptor, and smoking affects circulating hormone levels, results support evidence that steroid hormones play important role in breast carcinogenesis in BRCA1 mutation carriers
16227615 SRC-3 coactivator protein-protein complex formation is modulated by Pin1.
16135815 SRC-3 phosphorylation occurs only when either activated estrogen receptor alpha (ERalpha) or activated ERbeta is present.
15987430 Observational study of gene-disease association. (HuGE Navigator)
15900600 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15900600 There is no significant effect of AIB1 genetic variation on breast cancer risk in BRC1 or BRCA2 mutation carriers.
15788663 Observational study of gene-disease association. (HuGE Navigator)
15788663 Single Nucleotide Polymorphisms in NCOA3 is associated with breast cancer risk
15677324 The ability of SRC family coactivators to regulate the expression of one of these genes, PARD6B/Par6, was confirmed by using cells individually depleted of SRC-1.
15550471 the N-terminally deleted isoform of AIB1 can play a role in breast cancer development and/or progression
15548698 AIB1 is required for IGF-I-induced proliferation, signaling, cell survival, and gene expression in human breast cancer cells, independent of its role in estrogen receptor signaling
15448000 AIB1 has a major role in the multistage progression of pancreatic cancer
15289619 AIB1 plays a dual role in regulating ERalpha activity, one in recruiting transcription factors including other coactivators involved in gene activation and the other in regulating ERalpha protein degradation mediated by the ubiquitin-proteosome machinery.
15169882 results reveal an essential role of ACTR in control of breast cancer cell proliferation and implicate the ACTR-E2F1 pathway as a novel mechanism in antiestrogen resistance
14747462 HER2/Neu and ACTR may synergize to orchestrate mammary tumorigenesis through the dysregulation of the transcription factor ER81 and its target genes
14691461 AIB1-Delta3 causes a significant increase in the efficacy of 17beta-estradiol at both estrogen receptor-alpha (ER-alpha) and ER-beta in ovarian, breast and endometrial cancer cell lines
14684685 The polymorphic polyglutamine tract of the AIB1 gene is somatically unstable in breast cancer tissue and cell lines.
14648706 Polyglutamine repeat length in the AIB1 gene modifies breast cancer susceptibility in BRCA1 carriers
14557830 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14503806 AIB1 nuclear expression correlated with estrogen receptor alpha status in breast cancer; patients with AIB1 nuclear expression tended to be successfully treated by hormonal therapy
12833450 likely prognostic indicator for patients with breast tumors
12650696 SRC-3 has a role in the vasoprotective effects of estrogen and in cell migration, proliferation and cancers [review]
12602902 Observational study of gene-disease association. (HuGE Navigator)
11971985 Results show that IKK-mediated phosphorylation of SRC-3 is a regulated event that plays an important role and also substantiate the role of SRC-3 in multiple signaling pathways.
11929748 the effect of STAT5b-RARalpha on the activity of myeloid transcription factors including STAT3, and STAT5 as well as its molecular interactions with the nuclear receptor corepressor, SMRT, and nuclear receptor coactivator, TRAM-1.
11927493 Observational study of gene-disease association. (HuGE Navigator)
11927493 CAG/CAA repeat length in AIB1/SRC-3 gene may be associated with prosate cancer risk in Chinese men
11704662 Nuclear receptor coactivator 3 (NCOA3) is downregulated in HIV-1 Tat and NC cotransfection of HEK 293T cells
11161840 Observational study of gene-disease association. (HuGE Navigator)
11092404 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11056690 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCA      1 - 70
ILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSEN     71 - 140
VTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRMLMKTPHDILED    141 - 210
INASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNI    211 - 280
DTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSK    281 - 350
LFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLA    351 - 420
DPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSP    421 - 490
KIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPS    491 - 560
KVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSD    561 - 630
DRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAK    631 - 700
ITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCT    701 - 770
SSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLK    771 - 840
SSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVT    841 - 910
VTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVLQQQQQ    911 - 980
MLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDE    981 - 1050
RALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGP   1051 - 1120
PMQGGFHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQA   1121 - 1190
LELKMENPTAGGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQ   1191 - 1260
QQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGRVSS   1261 - 1330
PPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSG   1331 - 1400
HMGQMNMNPMPMSGMPMGPDQKYC                                                 1401 - 1424
//

Text Mined References (251)

PMID Year Title
26833126 2016 HER2 Signaling Drives DNA Anabolism and Proliferation through SRC-3 Phosphorylation and E2F1-Regulated Genes.
26449542 2015 Association of NCOA3 polymorphisms with Dyslipidemia in the Chinese Han population.
26369632 2016 SRC3 Phosphorylation at Serine 543 Is a Positive Independent Prognostic Factor in ER-Positive Breast Cancer.
26345978 2015 Roles of the AIB1 protein in the proliferation and transformation of human esophageal squamous cell carcinoma.
26267537 2015 Characterization of a Steroid Receptor Coactivator Small Molecule Stimulator that Overstimulates Cancer Cells and Leads to Cell Stress and Death.
26211391 2015 Correlation of the osteoarthritis susceptibility variants that map to chromosome 20q13 with an expression quantitative trait locus operating on NCOA3 and with functional variation at the polymorphism rs116855380.
26066330 2015 miR-137 Targets p160 Steroid Receptor Coactivators SRC1, SRC2, and SRC3 and Inhibits Cell Proliferation.
25970779 2015 Frequent amplification of AIB1, a critical oncogene modulating major signaling pathways, is associated with poor survival in gastric cancer.
25859975 2015 Estrogen receptor alpha/co-activator interaction assay: TR-FRET.
25728767 2015 Structure of a biologically active estrogen receptor-coactivator complex on DNA.
25531332 2015 NCOA3-mediated upregulation of mucin expression via transcriptional and post-translational changes during the development of pancreatic cancer.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
25263716 2015 The AIB1 gene polyglutamine repeat length polymorphism contributes to risk of epithelial ovarian cancer risk: a case-control study.
25263446 2015 Amplified in breast cancer 1 promotes colorectal cancer progression through enhancing notch signaling.
24875297 2014 Immunohistochemical localization of steroid receptor coactivators in chondrosarcoma: an in vivo tissue microarray study.
24788909 2014 Chaperonin CCT-mediated AIB1 folding promotes the growth of ER?-positive breast cancer cells on hard substrates.
24743578 2014 Identification of verrucarin a as a potent and selective steroid receptor coactivator-3 small molecule inhibitor.
24740565 2014 MicroRNA-195 regulates steroid receptor coactivator-3 protein expression in hepatocellular carcinoma cells.
24680642 2014 Expression of estrogen receptors, androgen receptor and steroid receptor coactivator-3 is negatively correlated to the differentiation of astrocytic tumors.
24678732 2014 Regulation of HER2 oncogene transcription by a multifunctional coactivator/corepressor complex.
24585635 2014 ERK3 promotes endothelial cell functions by upregulating SRC-3/SP1-mediated VEGFR2 expression.
24584933 2014 Steroid receptor coactivator-3 regulates glucose metabolism in bladder cancer cells through coactivation of hypoxia inducible factor 1?.
24390736 2014 Bufalin is a potent small-molecule inhibitor of the steroid receptor coactivators SRC-3 and SRC-1.
24304549 2013 NCOA3 is a selective co-activator of estrogen receptor ?-mediated transactivation of PLAC1 in MCF-7 breast cancer cells.
24282087 2014 Steroid receptor co-activator-3 promotes osteosarcoma progression through up-regulation of FoxM1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24134957 2013 Overexpression of steroid receptor coactivator-3 in bone cancers: an in vivo immunohistochemical study with tissue microarray.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23989986 2014 A meta-analysis of genome-wide association studies identifies novel variants associated with osteoarthritis of the hip.
23886194 2013 Steroid receptor coactivator-3 promotes bladder cancer through upregulation of CXCR4.
23851504 2014 The nuclear coactivator amplified in breast cancer 1 maintains tumor-initiating cells during development of ductal carcinoma in situ.
23774759 2013 Integrative genomics of gene and metabolic regulation by estrogen receptors ? and ?, and their coregulators.
23762395 2013 AIB1 cooperates with ER? to promote epithelial mesenchymal transition in breast cancer through SNAI1 activation.
23670096 2013 Oestrogen receptor co-activator AIB1 is a marker of tamoxifen benefit in postmenopausal breast cancer.
23660594 2013 Transcriptional repression of AIB1 by FoxG1 leads to apoptosis in breast cancer cells.
23652306 2013 Expression of steroid receptor coactivator 3 in ovarian epithelial cancer is a poor prognostic factor and a marker for platinum resistance.
23650284 2013 The steroid receptor coactivator-3 is required for the development of castration-resistant prostate cancer.
23606350 2013 Up-regulation of nuclear receptor coactivator amplified in breast cancer-1 in papillary thyroid carcinoma correlates with lymph node metastasis.
23514585 2013 PTEN suppresses the oncogenic function of AIB1 through decreasing its protein stability via mechanism involving Fbw7 alpha.
23511556 2013 AIB1 predicts bladder cancer outcome and promotes bladder cancer cell proliferation through AKT and E2F1.
23483928 2013 Polymorphic repeat length in the AIB1 gene and breast cancer risk in BRCA1 and BRCA2 mutation carriers: a meta-analysis of observational studies.
23433587 2013 The expression of AIB1 correlates with cellular proliferation in human prolactinomas.
23322234 2013 Prognostic relevance of AIB1 (NCoA3) amplification and overexpression in breast cancer.
23230135 2013 The role of AIB1 and PAX2 in primary breast cancer: validation of AIB1 as a negative prognostic factor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23065768 2012 Activation of rapid oestrogen signalling in aggressive human breast cancers.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22759465 2012 Alveolar macrophage cathelicidin deficiency in severe sarcoidosis.
22627138 2012 The interaction between hepatitis B virus X protein and AIB1 oncogene is required for the activation of NF?B signal transduction.
22560224 2012 Ablation of steroid receptor coactivator-3 resembles the human CACT metabolic myopathy.
22550166 2012 AIB1:ER? transcriptional activity is selectively enhanced in aromatase inhibitor-resistant breast cancer cells.
22505454 2012 ERK3 signals through SRC-3 coactivator to promote human lung cancer cell invasion.
22430150 2012 Steroid receptor coactivator 3 regulates autophagy in breast cancer cells through macrophage migration inhibitory factor.
22371647 2012 Amplifications of NCOA3 gene in colorectal cancers in a Chinese population.
22370642 2013 The nuclear cofactor RAC3/AIB1/SRC-3 enhances Nrf2 signaling by interacting with transactivation domains.
22342158 2012 Role of the nuclear receptor coactivator AIB1/SRC-3 in angiogenesis and wound healing.
22307791 2012 AIB1 polymorphisms with breast cancer susceptibility: a pooled analysis of variation in BRCA1/2 mutation carriers and non-carriers.
22283414 2012 The transcriptional activity of co-activator AIB1 is regulated by the SUMO E3 ligase PIAS1.
22213475 2012 Amplified in breast cancer 1 enhances human cholangiocarcinoma growth and chemoresistance by simultaneous activation of Akt and Nrf2 pathways.
22163316 2011 Phosphorylation of AIB1 at mitosis is regulated by CDK1/CYCLIN B.
22147914 2011 Cullin 3 mediates SRC-3 ubiquitination and degradation to control the retinoic acid response.
22142990 2012 Estradiol increases cell growth in human astrocytoma cell lines through ER? activation and its interaction with SRC-1 and SRC-3 coactivators.
22052107 2012 AIB1 as an independent prognostic marker in hepatocellular carcinoma after hepatic resection.
22035181 2011 Expression of AIB1 protein as a prognostic factor in breast cancer.
22002538 2011 Oestrogen receptor-co-factor-chromatin specificity in the transcriptional regulation of breast cancer.
21914189 2011 Regulation of the BRCA1 gene by an SRC3/53BP1 complex.
21871888 2011 Transcriptional repression of the tumor suppressor DRO1 by AIB1.
21735116 2012 Prognostic value of novel biomarkers in astrocytic brain tumors: nuclear receptor co-regulators AIB1, TIF2, and PELP1 are associated with high tumor grade and worse patient prognosis.
21636853 2011 Role of the nuclear receptor coactivator AIB1-Delta4 splice variant in the control of gene transcription.
21601620 2011 Investigation of the 1758G>C and 2880A>G variants within the NCOA3 gene in a breast cancer affected Australian population.
21577200 2011 Tumor-suppressor role for the SPOP ubiquitin ligase in signal-dependent proteolysis of the oncogenic co-activator SRC-3/AIB1.
21454665 2011 SYT-SSX1 (synovial sarcoma translocated) regulates PIASy ligase activity to cause overexpression of NCOA3 protein.
21269460 2011 Initial characterization of the human central proteome.
21220509 2011 Homeostatic levels of SRC-2 and SRC-3 promote early human adipogenesis.
21184786 2011 Deletion of steroid receptor coactivator-3 gene ameliorates hepatic steatosis.
21182203 2011 A large set of estrogen receptor ?-interacting proteins identified by tandem affinity purification in hormone-responsive human breast cancer cell nuclei.
21059860 2011 Distinctive functions of p160 steroid receptor coactivators in proliferation of an estrogen-independent, tamoxifen-resistant breast cancer cell line.
21047772 2010 HOXC8 inhibits androgen receptor signaling in human prostate cancer cells by inhibiting SRC-3 recruitment to direct androgen target genes.
20852035 2010 Overexpression and gender-specific differences of SRC-3 (SRC-3/AIB1) immunoreactivity in human non-small cell lung cancer: an in vivo study.
20663904 2010 Steroid receptor coactivator-3 expression in lung cancer and its role in the regulation of cancer cell survival and proliferation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20422428 2011 The AIB1 gene polyglutamine repeat length polymorphism and the risk of breast cancer development.
20392877 2010 Cooperative activation of cyclin D1 and progesterone receptor gene expression by the SRC-3 coactivator and SMRT corepressor.
20381444 2010 Polymorphisms in genes of the steroid hormone biosynthesis and metabolism pathways and endometrial cancer risk.
20332317 2010 Effect of low-dose tamoxifen on steroid receptor coactivator 3/amplified in breast cancer 1 in normal and malignant human breast tissue.
20305690 2010 Overexpression of transcriptional coactivator AIB1 promotes hepatocellular carcinoma progression by enhancing cell proliferation and invasiveness.
20181721 2010 Global characterization of transcriptional impact of the SRC-3 coregulator.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20159552 2010 SRC-3Delta4 mediates the interaction of EGFR with FAK to promote cell migration.
20155818 2010 Genetic ablation of steroid receptor coactivator-3 promotes PPAR-beta-mediated alternative activation of microglia in experimental autoimmune encephalomyelitis.
20137343 2009 [Effects of gambogic acid on the regulation of steroid receptor coactivator-3 in A549 cells].
20124470 2010 Deregulated E2F and the AAA+ coregulator ANCCA drive proto-oncogene ACTR/AIB1 overexpression in breast cancer.
20086010 2010 Identification of SRC3/AIB1 as a preferred coactivator for hormone-activated androgen receptor.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20064830 2010 Overexpression of AIB1 negatively affects survival of surgically resected non-small-cell lung cancer patients.
20003447 2009 Nuclear receptor coregulator SNP discovery and impact on breast cancer risk.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19716257 2010 The role of steroid receptor coactivator-3 (SRC-3) in human malignant disease.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19652917 2010 The interaction between thymine DNA glycosylase and nuclear receptor coactivator 3 is required for the transcriptional activation of nuclear hormone receptors.
19628566 2010 AIB1 is a predictive factor for tamoxifen response in premenopausal women.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19552757 2009 Overexpression of AIB1 predicts resistance to chemoradiotherapy and poor prognosis in patients with primary esophageal squamous cell carcinoma.
19491275 2009 Estrogen-related receptor alpha expression and function is associated with the transcriptional coregulator AIB1 in breast carcinoma.
19470168 2009 NPAS2 and PER2 are linked to risk factors of the metabolic syndrome.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19433130 2009 Gambogic acid induces G0/G1 arrest and apoptosis involving inhibition of SRC-3 and inactivation of Akt pathway in K562 leukemia cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19339517 2009 CK1delta modulates the transcriptional activity of ERalpha via AIB1 in an estrogen-dependent manner and regulates ERalpha-AIB1 interactions.
19285025 2009 AIB1 is required for the acquisition of epithelial growth factor receptor-mediated tamoxifen resistance in breast cancer cells.
19277704 2009 Estrogen signaling in colorectal carcinoma microenvironment: expression of ERbeta1, AIB-1, and TIF-2 is upregulated in cancer-associated myofibroblasts and correlates with disease progression.
19255064 2009 Vitamin D-related genes, serum vitamin D concentrations and prostate cancer risk.
19198856 2009 Estrogen receptor alpha/beta, AIB1, and TIF2 in colorectal carcinogenesis: do coregulators have prognostic significance?
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19176441 2009 Genome-wide interrogation of germline genetic variation associated with treatment response in childhood acute lymphoblastic leukemia.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19144644 2009 SUG-1 plays proteolytic and non-proteolytic roles in the control of retinoic acid target genes via its interaction with SRC-3.
19102007 2008 Amplified in breast cancer 1 expression in breast cancer.
19095746 2009 Unique roles of p160 coactivators for regulation of breast cancer cell proliferation and estrogen receptor-alpha transcriptional activity.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19052561 2009 Vitamin D receptor and coactivators SRC2 and 3 regulate epidermis-specific sphingolipid production and permeability barrier formation.
18922467 2008 Essential phosphatases and a phospho-degron are critical for regulation of SRC-3/AIB1 coactivator function and turnover.
18845648 2009 Expression and significance of androgen receptor coactivators in urothelial carcinoma of the bladder.
18827493 2008 Role of AIB1 for tamoxifen resistance in estrogen receptor-positive breast cancer cells.
18798693 2008 Identification of COUP-TFII orphan nuclear receptor as a retinoic acid-activated receptor.
18765637 2008 Tyrosine phosphorylation of the nuclear receptor coactivator AIB1/SRC-3 is enhanced by Abl kinase and is required for its activity in cancer cells.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18644862 2008 The AIB1 oncogene promotes breast cancer metastasis by activation of PEA3-mediated matrix metalloproteinase 2 (MMP2) and MMP9 expression.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18593949 2008 Steroid receptor coactivator-3/AIB1 promotes cell migration and invasiveness through focal adhesion turnover and matrix metalloproteinase expression.
18593948 2008 Phosphoinositide 3-kinase/AKT signaling can promote AIB1 stability independently of GSK3 phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18521745 2009 Estrogen receptor co-activator (AIB1) protein expression by automated quantitative analysis (AQUA) in a breast cancer tissue microarray and association with patient outcome.
18426732 2008 Overexpression of AIB1 in nasopharyngeal carcinomas correlates closely with advanced tumor stage.
18385039 2008 SRC-3 transcription-coupled activation, degradation, and the ubiquitin clock: is there enough coactivator to go around in cells?
18313384 2008 Atypical protein kinase C regulates dual pathways for degradation of the oncogenic coactivator SRC-3/AIB1.
18246597 2008 Protein expression and amplification of AIB1 in human urothelial carcinoma of the bladder and overexpression of AIB1 is a new independent prognostic marker of patient survival.
18162290 2008 Proto-oncogene ACTR/AIB1 promotes cancer cell invasion by up-regulating specific matrix metalloproteinase expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998543 2007 ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification.
17968310 2008 The p160 nuclear receptor co-activator RAC3 exerts an anti-apoptotic role through a cytoplasmatic action.
17927986 2007 RAC3 down-regulation sensitizes human chronic myeloid leukemia cells to TRAIL-induced apoptosis.
17805331 2008 NCOA3, a new fusion partner for MOZ/MYST3 in M5 acute myeloid leukemia.
17646391 2007 Regulation of SRC-3 intercompartmental dynamics by estrogen receptor and phosphorylation.
17636398 2008 Epidermal growth factor receptor (EGFR) and the estrogen receptor modulator amplified in breast cancer (AIB1) for predicting clinical outcome after adjuvant tamoxifen in breast cancer.
17574025 2007 SRC-3 coactivator functional lifetime is regulated by a phospho-dependent ubiquitin time clock.
17532621 2007 Clinical implications of steroid receptor coactivator (SRC)-3 in uterine endometrial cancers.
17441340 2007 [Expression of AIB1 protein in gynecological tumors].
17360478 2007 Steroid receptor coactivator 3 is a coactivator for myocardin, the regulator of smooth muscle transcription and differentiation.
17223341 2007 Differential role of two VDR coactivators, DRIP205 and SRC-3, in keratinocyte proliferation and differentiation.
17082781 2007 Regulation of human epidermal keratinocyte differentiation by the vitamin D receptor and its coactivators DRIP205, SRC2, and SRC3.
17043108 2007 The activity and stability of the transcriptional coactivator p/CIP/SRC-3 are regulated by CARM1-dependent methylation.
17008696 2006 Prognostic significance of nuclear receptor coactivator-3 overexpression in primary cutaneous melanoma.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16957778 2006 The catalytic subunit of the proteasome is engaged in the entire process of estrogen receptor-regulated transcription.
16951183 2006 E6AP mediates regulated proteasomal degradation of the nuclear receptor coactivator amplified in breast cancer 1 in immortalized cells.
16951154 2006 Male germ cell-associated kinase, a male-specific kinase regulated by androgen, is a coactivator of androgen receptor in prostate cancer cells.
16940181 2006 Mir-17-5p regulates breast cancer cell proliferation by inhibiting translation of AIB1 mRNA.
16923966 2006 Signaling within a coactivator complex: methylation of SRC-3/AIB1 is a molecular switch for complex disassembly.
16921507 2006 ACTR/AIB1/SRC-3 and androgen receptor control prostate cancer cell proliferation and tumor growth through direct control of cell cycle genes.
16916939 2006 Stimulation of steroid receptor coactivator-3 (SRC-3) gene overexpression by a positive regulatory loop of E2F1 and SRC-3.
16760465 2006 Coordinated regulation of AIB1 transcriptional activity by sumoylation and phosphorylation.
16670003 2006 AIB1 gene amplification and the instability of polyQ encoding sequence in breast cancer cell lines.
16648476 2006 Direct control of cell cycle gene expression by proto-oncogene product ACTR, and its autoregulation underlies its transforming activity.
16458427 2007 SRC-3/AIB1 protein and gene amplification levels in human esophageal squamous cell carcinomas.
16456540 2006 P38MAPK-dependent phosphorylation and degradation of SRC-3/AIB1 and RARalpha-mediated transcription.
16439211 2006 The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome.
16434590 2006 The AIB1 polyglutamine repeat does not modify breast cancer risk in BRCA1 and BRCA2 mutation carriers.
16365010 2005 AIB1 polymorphisms predict aggressive ovarian cancer phenotype.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16298470 2005 Steroid receptor coactivator-3, a homolog of Taiman that controls cell migration in the Drosophila ovary, regulates migration of human ovarian cancer cells.
16263829 2006 Nuclear receptor coactivator-3 alleles are associated with serum bioavailable testosterone, insulin-like growth factor-1, and vertebral bone mass in men.
16244359 2006 The joint effect of smoking and AIB1 on breast cancer risk in BRCA1 mutation carriers.
16227615 2005 Peptidyl-prolyl isomerase 1 (Pin1) serves as a coactivator of steroid receptor by regulating the activity of phosphorylated steroid receptor coactivator 3 (SRC-3/AIB1).
16135815 2005 Rapid estrogen-induced phosphorylation of the SRC-3 coactivator occurs in an extranuclear complex containing estrogen receptor.
15987430 2005 The AIB1 glutamine repeat polymorphism is not associated with risk of breast cancer before age 40 years in Australian women.
15900600 2005 Breast cancer risk in BRCA1 and BRCA2 mutation carriers and polyglutamine repeat length in the AIB1 gene.
15831516 2005 Functional genomics identifies a mechanism for estrogen activation of the retinoic acid receptor alpha1 gene in breast cancer cells.
15788663 2005 Association of NCOA3 polymorphisms with breast cancer risk.
15698540 2004 FLASH interacts with p160 coactivator subtypes and differentially suppresses transcriptional activity of steroid hormone receptors.
15677324 2005 Identification of target genes in breast cancer cells directly regulated by the SRC-3/AIB1 coactivator.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15550471 2005 Overexpression of an N-terminally truncated isoform of the nuclear receptor coactivator amplified in breast cancer 1 leads to altered proliferation of mammary epithelial cells in transgenic mice.
15548698 2004 The nuclear receptor coactivator AIB1 mediates insulin-like growth factor I-induced phenotypic changes in human breast cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448000 2004 Overexpression of the nuclear receptor coactivator AIB1 (SRC-3) during progression of pancreatic adenocarcinoma.
15383283 2004 Selective phosphorylations of the SRC-3/AIB1 coactivator integrate genomic reponses to multiple cellular signaling pathways.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15289619 2004 Coactivator AIB1 links estrogen receptor transcriptional activity and stability.
15169882 2004 ACTR/AIB1 functions as an E2F1 coactivator to promote breast cancer cell proliferation and antiestrogen resistance.
14747462 2004 Concerted activation of ETS protein ER81 by p160 coactivators, the acetyltransferase p300 and the receptor tyrosine kinase HER2/Neu.
14691461 2004 Impact of the nuclear receptor coactivator AIB1 isoform AIB1-Delta3 on estrogenic ligands with different intrinsic activity.
14684685 2003 Somatic instability of the DNA sequences encoding the polymorphic polyglutamine tract of the AIB1 gene.
14648706 2004 Polyglutamine repeat length in the AIB1 gene modifies breast cancer susceptibility in BRCA1 carriers.
14645221 2004 Histone acetyltransferase-dependent chromatin remodeling and the vascular clock.
14611647 2004 The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins.
14557830 2004 Correlates of obesity in postmenopausal women with breast cancer: comparison of genetic, demographic, disease-related, life history and dietary factors.
14503806 2003 Clinical significance of AIB1 expression in human breast cancer.
12917342 2003 BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation.
12833450 2003 Elevated expression levels of NCOA3, TOP1, and TFAP2C in breast tumors as predictors of poor prognosis.
12650696 2002 Molecular structure and biological function of the cancer-amplified nuclear receptor coactivator SRC-3/AIB1.
12602902 2003 Polymorphisms in steroid hormone pathway genes and mammographic density.
12529369 2003 Interactions of SKIP/NCoA-62, TFIIB, and retinoid X receptor with vitamin D receptor helix H10 residues.
12497632 2003 Dynamics of CAG repeat loci revealed by the analysis of their variability.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12145209 2002 Targeting of SWI/SNF chromatin remodelling complexes to estrogen-responsive genes.
12082103 2002 The activation function-1 domain of Nur77/NR4A1 mediates trans-activation, cell specificity, and coactivator recruitment.
11971985 2002 Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/TRAM-1) Coactivator activity by I kappa B kinase.
11929748 2002 Interactions of STAT5b-RARalpha, a novel acute promyelocytic leukemia fusion protein, with retinoic acid receptor and STAT3 signaling pathways.
11927493 2002 Polymorphic CAG/CAA repeat length in the AIB1/SRC-3 gene and prostate cancer risk: a population-based case-control study.
11823864 2002 Mutual synergistic folding in recruitment of CBP/p300 by p160 nuclear receptor coactivators.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11708882 2001 Detection of antisense and ribozyme accessible sites on native mRNAs: application to NCOA3 mRNA.
11704662 2002 Nuclear receptor coactivator p160 proteins enhance the HIV-1 long terminal repeat promoter by bridging promoter-bound factors and the Tat-P-TEFb complex.
11477071 2001 Characterization of the physical interaction between estrogen receptor alpha and JUN proteins.
11389589 2001 Structure-function evaluation of ER alpha and beta interplay with SRC family coactivators. ER selective ligands.
11353774 2001 Forkhead homologue in rhabdomyosarcoma functions as a bifunctional nuclear receptor-interacting protein with both coactivator and corepressor functions.
11316771 2001 A splice variant of estrogen receptor beta missing exon 3 displays altered subnuclear localization and capacity for transcriptional activation.
11279242 2001 The human homologue of the yeast DNA repair and TFIIH regulator MMS19 is an AF-1-specific coactivator of estrogen receptor.
11266503 2001 Regulation of glucocorticoid receptor activity by 14--3-3-dependent intracellular relocalization of the corepressor RIP140.
11250900 2001 A subfamily of RNA-binding DEAD-box proteins acts as an estrogen receptor alpha coactivator through the N-terminal activation domain (AF-1) with an RNA coactivator, SRA.
11161840 2001 Genetic factors related to racial variation in plasma levels of insulin-like growth factor-1: implications for premenopausal breast cancer risk.
11094166 2000 RAC-3 is a NF-kappa B coactivator.
11092404 2000 Alleles of the estrogen receptor alpha-gene and an estrogen receptor cotranscriptional activator gene, amplified in breast cancer-1 (AIB1), are associated with quantitative calcaneal ultrasound.
11087842 2000 Regulation of somatic growth by the p160 coactivator p/CIP.
11056690 2000 Polymorphic repeat in AIB1 does not alter breast cancer risk.
11050174 2000 Endogenously expressed estrogen receptor and coactivator AIB1 interact in MCF-7 human breast cancer cells.
11050077 2001 Synergistic enhancement of nuclear receptor function by p160 coactivators and two coactivators with protein methyltransferase activities.
10965917 2000 Thyroid receptor activator molecule, TRAM-1, is an androgen receptor coactivator.
10866661 2000 AIB1 is a conduit for kinase-mediated growth factor signaling to the estrogen receptor.
10681591 2000 Differential mechanisms of nuclear receptor regulation by receptor-associated coactivator 3.
10598588 1999 Constitutive activation of transcription and binding of coactivator by estrogen-related receptors 1 and 2.
10504300 1999 Characterization of bone morphogenetic protein-6 signaling pathways in osteoblast differentiation.
10490106 1999 Regulation of hormone-induced histone hyperacetylation and gene activation via acetylation of an acetylase.
9832502 1998 Ligand-independent recruitment of steroid receptor coactivators to estrogen receptor by cyclin D1.
9812974 1998 SRC-1 and GRIP1 coactivate transcription with hepatocyte nuclear factor 4.
9727751 1998 Polymorphic exonic CAG microsatellites in the gene amplified in breast cancer (AIB1 gene).
9445475 1998 Transcription factor-specific requirements for coactivators and their acetyltransferase functions.
9346901 1997 TRAM-1, A novel 160-kDa thyroid hormone receptor activator molecule, exhibits distinct properties from steroid receptor coactivator-1.
9267036 1997 Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300.
9252329 1997 AIB1, a steroid receptor coactivator amplified in breast and ovarian cancer.
9238002 1997 RAC3, a steroid/nuclear receptor-associated coactivator that is related to SRC-1 and TIF2.
9225980 1997 cDNAs with long CAG trinucleotide repeats from human brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8758910 1996 Hybrid selection of transcribed sequences from microdissected DNA: isolation of genes within amplified region at 20q11-q13.2 in breast cancer.
7791754 1995 Human type II receptor for bone morphogenic proteins (BMPs): extension of the two-kinase receptor model to the BMPs.