Property Summary

NCBI Gene PubMed Count 249
PubMed Score 480.15
PubTator Score 296.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.300 4.8e-03
atypical teratoid / rhabdoid tumor 1.300 1.5e-04
Chronic Lymphocytic Leukemia 1.452 9.4e-03
Crohn's disease -1.381 3.2e-03
ependymoma 1.200 1.6e-02
glioblastoma 1.200 1.3e-05
intraductal papillary-mucinous neoplasm ... 1.300 2.6e-02
lung cancer -1.300 3.6e-04
malignant mesothelioma -1.400 1.8e-06
medulloblastoma, large-cell 1.400 3.7e-06
non primary Sjogren syndrome sicca -1.200 1.3e-02
oligodendroglioma 1.100 1.2e-02
osteosarcoma 2.202 8.6e-07
ovarian cancer 1.900 6.2e-05
Pick disease 1.600 2.5e-05
primitive neuroectodermal tumor 1.500 1.9e-06
psoriasis 1.900 8.3e-05
spina bifida -1.171 4.3e-02
ulcerative colitis -1.600 9.6e-03

Protein-protein Interaction (1)

Gene RIF (198)

AA Sequence

MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCA      1 - 70
ILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSEN     71 - 140
VTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRMLMKTPHDILED    141 - 210
INASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNI    211 - 280
DTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSK    281 - 350
LFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLA    351 - 420
DPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSP    421 - 490
KIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPS    491 - 560
KVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSD    561 - 630
DRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAK    631 - 700
ITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCT    701 - 770
SSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLK    771 - 840
SSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVT    841 - 910
VTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVLQQQQQ    911 - 980
MLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDE    981 - 1050
RALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGP   1051 - 1120
PMQGGFHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQA   1121 - 1190
LELKMENPTAGGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQ   1191 - 1260
QQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGRVSS   1261 - 1330
PPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSG   1331 - 1400
HMGQMNMNPMPMSGMPMGPDQKYC                                                 1401 - 1424
//

Text Mined References (263)

PMID Year Title