Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.75
PubTator Score 6.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 1.1e-03
osteosarcoma -1.902 1.2e-03
glioblastoma 1.100 1.3e-02
medulloblastoma, large-cell -1.400 3.5e-04
adrenocortical carcinoma -1.173 7.3e-03
non-small cell lung cancer -1.681 2.3e-14
intraductal papillary-mucinous carcinoma... -1.300 1.7e-02
lung cancer -2.500 5.5e-05
diabetes mellitus -1.200 4.7e-02
interstitial cystitis 2.100 1.3e-03
adult high grade glioma 1.100 2.1e-02
group 3 medulloblastoma -1.100 1.3e-02
pilocytic astrocytoma 1.600 1.7e-06
primary Sjogren syndrome 2.300 8.6e-05
subependymal giant cell astrocytoma 2.308 1.8e-02
invasive ductal carcinoma 1.214 3.4e-04
lung carcinoma -3.000 1.5e-28
spina bifida 1.010 3.0e-02
ulcerative colitis 1.900 2.4e-04
ovarian cancer -2.400 1.7e-07
head and neck cancer and chronic obstruc... 1.100 7.7e-03

 GWAS Trait (1)

Gene RIF (2)

PMID Text
17696648 the Hem-1/Nap1 component of the Scar/WAVE complex localizes to propagating waves that appear to organize the leading edge of a motile neutrophil
16417406 versatile Hem-1-containing complexes coordinate diverse regulatory signals at the leading edge of polarized neutrophils, including but not confined to those involving Verprolin-homologous protein-dependent actin polymerization

AA Sequence

MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNS      1 - 70
TQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTS     71 - 140
VILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMVLEYDHPLKKLTEEFGPHTKAVSGALLSLHF    141 - 210
LFVRRNQGAEQWRSAQLLSLISNPPAMINPANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKL    211 - 280
WKLCLQGSLYITLIREDVLQVHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKE    281 - 350
LETVLADEPGLLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR    351 - 420
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKFEFSGLRLDWF    421 - 490
RLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLSTFCFHLRIFEKMFAMTLEESA    491 - 560
MLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNSFLEELAKQTSNCVLEICAEQRNLSEQLLPK    561 - 630
HCATTISKAKNKKTRKQRQTPRKGEPERDKPGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFE    631 - 700
HTIFPSEYLSSHLEARLNRAIVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNAL    701 - 770
LQQTQPLDSCGEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL    771 - 840
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTGAENVLKRMTI    841 - 910
IGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPALVAAI    911 - 980
ANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNK    981 - 1050
NIETHLKEFLVVASVSLLQLGQETDKLKTRNRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREV   1051 - 1120
SRAFHLN                                                                  1121 - 1127
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
17875758 2007 ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.
17696648 2007 An actin-based wave generator organizes cell motility.
16541075 2006 The finished DNA sequence of human chromosome 12.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
7643388 1995 The HEM proteins: a novel family of tissue-specific transmembrane proteins expressed from invertebrates through mammals with an essential function in oogenesis.
1932118 1991 Hem-1, a potential membrane protein, with expression restricted to blood cells.