Property Summary

NCBI Gene PubMed Count 75
PubMed Score 273.94
PubTator Score 127.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Atopic dermatitis 952 0.0 0.9
Disease Target Count
Chronic granulomatous disease 13

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.714 7.7e-04
acute myeloid leukemia 1.200 2.4e-02
adrenocortical carcinoma -1.108 7.0e-03
adult high grade glioma 1.200 1.8e-03
Astrocytoma, Pilocytic 1.100 2.1e-06
cutaneous lupus erythematosus 1.500 3.3e-03
glioblastoma 1.100 4.8e-02
interstitial cystitis 1.500 2.9e-03
invasive ductal carcinoma 1.001 9.2e-04
lung cancer -1.600 3.0e-05
lung carcinoma -2.200 2.0e-27
non-small cell lung cancer -1.611 3.3e-16
osteosarcoma -3.995 2.4e-05
periodontitis 1.200 6.4e-27
tuberculosis 1.100 1.0e-03
ulcerative colitis 1.700 2.5e-05

Gene RIF (40)

AA Sequence

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE      1 - 70
ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS     71 - 140
EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG    141 - 210
TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR    211 - 280
EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP               281 - 339
//

Text Mined References (76)

PMID Year Title