Property Summary

NCBI Gene PubMed Count 16
PubMed Score 29.78
PubTator Score 11.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.900 1.1e-07
psoriasis 1.800 4.0e-170
osteosarcoma -1.066 4.9e-02
glioblastoma 2.400 5.6e-06
group 3 medulloblastoma 2.500 4.4e-06
atypical teratoid / rhabdoid tumor 2.300 6.5e-10
medulloblastoma, large-cell 2.900 3.6e-07
primitive neuroectodermal tumor 2.600 1.4e-05
adrenocortical carcinoma 1.066 7.3e-03
non-small cell lung cancer 2.271 2.1e-25
lung cancer 2.700 2.4e-05
colon cancer 1.800 2.8e-03
breast carcinoma 1.400 2.4e-05
lung adenocarcinoma 1.400 5.0e-06
pediatric high grade glioma 2.000 4.4e-07
Breast cancer 1.700 4.6e-11
ductal carcinoma in situ 1.200 1.6e-03
invasive ductal carcinoma 1.800 3.3e-05
ovarian cancer 1.800 2.4e-07

Gene RIF (3)

PMID Text
21151026 Caspase-3-mediated degradation of condensin Cap-H regulates mitotic cell death.
19454010 Interaction of HIV-1 Tat with CAPH in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
16543152 Our results identify a SSB-specific response of condensin I through PARP-1 and demonstrate a role for condensin in SSB. repair.

AA Sequence

MGPPGPALPATMNNSSSETRGHPHSASSPSERVFPMPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRS      1 - 70
RVFDLQFSTDSPRLLASPSSRSIDISATIPKFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEI     71 - 140
LKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKK    141 - 210
AVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDV    211 - 280
QTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVF    281 - 350
DINAEVDESDCGDFPDGSLGDDFDANDEPDHTAVGDHEEFRSWKEPCQVQSCQEEMISLGDGDIRTMCPL    351 - 420
LSMKPGEYSYFSPRTMSMWAGPDHWRFRPRRKQDAPSQSENKKKSTKKDFEIDFEDDIDFDVYFRKTKAA    421 - 490
TILTKSTLENQNWRATTLPTDFNYNVDTLVQLHLKPGTRLLKMAQGHRVETEHYEEIEDYDYNNPNDTSN    491 - 560
FCPGLQAADSDDEDLDDLFVGPVGNSDLSPYPCHPPKTAQQNGDTPEAQGLDITTYGESNLVAEPQKVNK    561 - 630
IEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPP    631 - 700
VMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD                                 701 - 741
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21730191 2011 DEAD-box RNA helicase Belle/DDX3 and the RNA interference pathway promote mitotic chromosome segregation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21151026 2011 Caspase-3-mediated degradation of condensin Cap-H regulates mitotic cell death.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17268547 2007 Reconstitution and subunit geometry of human condensin complexes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16543152 2006 Condensin I interacts with the PARP-1-XRCC1 complex and functions in DNA single-strand break repair.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11694586 2001 Cell cycle-dependent expression and nucleolar localization of hCAP-H.
11136719 2001 Chromosome condensation by a human condensin complex in Xenopus egg extracts.
9417923 1997 Localization of BRRN1, the human homologue of Drosophila barr, to 2q11.2.
9160743 1997 Condensins, chromosome condensation protein complexes containing XCAP-C, XCAP-E and a Xenopus homolog of the Drosophila Barren protein.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.