Property Summary

NCBI Gene PubMed Count 37
PubMed Score 145.42
PubTator Score 25.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.300 5.6e-03
group 3 medulloblastoma -1.500 1.6e-02
Pick disease -1.400 9.8e-03
pituitary cancer 1.900 2.6e-04

 MGI Phenotype (1)

Gene RIF (17)

PMID Text
26758378 This study aims to analyze the influences of single-nucleotide polymorphism in the NCAN-CILP2 region on non-alcoholic fatty liver disease and plasma lipid levels in the Asian and Pacific ethnic groups.
25801500 NCAN genotype is associated with limbic gray matter alterations in healthy and subjects with major depression in brain areas implicated in emotion perception and regulation
25220293 current data demonstrate that common genetic variation in NCAN influences both neural processing and cognitive performance in healthy subjects.
24978903 Conditional analysis shows that a neighbouring gene, TM6SF2, not NCAN, is responsible for the Chr 19 GWAS locus previously associated with fibrosing non-alcoholic fatty liver disease (NAFLD).
24946282 The frequency of the NCAN rs2228603 T allele was significantly increased in patients with HCC due to ALD (15.1%) compared to alcoholic cirrhosis without HCC (9.3%), alcoholic controls (7.2%), healthy controls (7.9%), and HCV associated HCC (9.1%).
23795679 NCAN risk variant is associated with cortical folding and thickness in bipolar disorder and schizophrenia.
23594525 NCAN rs2228603[T] is a risk factor for liver inflammation and fibrosis, suggesting that this locus is responsible for progression from steatosis to steatohepatitis.
23198940 no genetic association between risk allele A for NCAN locus rs1064395 and schizophrenia.
22952076 In the combined patient sample, the NCAN risk allele was significantly associated with the "mania" factor, in particular the subdimension "overactivity.
22497794 The rs1064395 A-allele was significantly over-represented in schizophrenia patients compared to controls. Our data suggest that genetic variation in NCAN is a common risk factor for bipolar disorder and schizophrenia.
22208664 Sex (male)-specific association of rs16996148 SNP in the NCAN/CILP2/PBX4 and serum lipid levels is observed both the Mulao and Han ethnic groups.
21997179 High neurocan is associated with the invasive phenotype of low-grade astrocytoma.
21353194 Genetic variation in the neurocan gene (NCAN) showed genome-wide significant association with bipolar disorder.
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
19148283 Observational study of gene-disease association. (HuGE Navigator)
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAA      1 - 70
RDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRC     71 - 140
QVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQEACRLSSAIIAAPRHLQAAFEDGFDNCDAGW    141 - 210
LSDRTVRYPITQSRPGCYGDRSSLPGVRSYGRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQC    211 - 280
RRQGAALASVGQLHLAWHEGLDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAER    281 - 350
FDAYCFRAHHPTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE    351 - 420
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRRGRFKGLNGRY    421 - 490
FQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSPWADLTNEVDMPGAGSAGGKS    491 - 560
SPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATPDLFWSPLEATVSAPSPAPWEAFPVATSPDL    561 - 630
PMMAMLRGPKEWMLPHPTPISTEANRVEAHGEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPES    631 - 700
PRADFRETGETSPAQVNKAEHSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSG    701 - 770
LQATVDEVQDPWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA    771 - 840
SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPEPEDQVETQGT    841 - 910
SGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLLPVTLGIEDFELEVLAGSPGV    911 - 980
ESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHGGTCNANGTMYGCSCDQGFAGENCEIDIDDC    981 - 1050
LCSPCENGGTCIDEVNGFVCLCLPSYGGSFCEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRS   1051 - 1120
GHLTSVHSPEEHSFINSFGHENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAH   1121 - 1190
ESGRWNDVPCNYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS   1191 - 1260
NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNFC            1261 - 1321
//

Text Mined References (38)

PMID Year Title
26758378 2016 Replication analysis of genetic association of the NCAN-CILP2 region with plasma lipid levels and non-alcoholic fatty liver disease in Asian and Pacific ethnic groups.
25801500 2015 NCAN Cross-Disorder Risk Variant Is Associated With Limbic Gray Matter Deficits in Healthy Subjects and Major Depression.
25220293 2015 A genome-wide supported psychiatric risk variant in NCAN influences brain function and cognitive performance in healthy subjects.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24978903 2014 TM6SF2 rs58542926 influences hepatic fibrosis progression in patients with non-alcoholic fatty liver disease.
24946282 2014 A common polymorphism in the NCAN gene is associated with hepatocellular carcinoma in alcoholic liver disease.
24618891 2014 Genome-wide association study reveals two new risk loci for bipolar disorder.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23795679 2014 Common variation in NCAN, a risk factor for bipolar disorder and schizophrenia, influences local cortical folding in schizophrenia.
23594525 2013 Genetic variation at NCAN locus is associated with inflammation and fibrosis in non-alcoholic fatty liver disease in morbid obesity.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23198940 2012 Assessment of relatedness between neurocan gene as bipolar disorder susceptibility locus and schizophrenia.
22952076 2012 Studies in humans and mice implicate neurocan in the etiology of mania.
22497794 2012 Association between schizophrenia and common variation in neurocan (NCAN), a genetic risk factor for bipolar disorder.
22208664 2011 Sex-specific association of rs16996148 SNP in the NCAN/CILP2/PBX4 and serum lipid levels in the Mulao and Han populations.
21997179 2012 Brevican, neurocan, tenascin-C and versican are mainly responsible for the invasiveness of low-grade astrocytoma.
21353194 2011 Genome-wide association study identifies genetic variation in neurocan as a susceptibility factor for bipolar disorder.
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
19148283 2009 Genetic differences between the determinants of lipid profile phenotypes in African and European Americans: the Jackson Heart Study.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10934197 2000 Characterization of the L1-neurocan-binding site. Implications for L1-L1 homophilic binding.
9795216 1998 Characterization of the human neurocan gene, CSPG3.
9507007 1998 High affinity binding and overlapping localization of neurocan and phosphacan/protein-tyrosine phosphatase-zeta/beta with tenascin-R, amphoterin, and the heparin-binding growth-associated molecule.
9341124 1997 Mapping of a defined neurocan binding site to distinct domains of tenascin-C.
8910306 1996 Analysis of neurocan structures interacting with the neural cell adhesion molecule N-CAM.
8663515 1996 TAG-1/axonin-1 is a high-affinity ligand of neurocan, phosphacan/protein-tyrosine phosphatase-zeta/beta, and N-CAM.
7513709 1994 The neuronal chondroitin sulfate proteoglycan neurocan binds to the neural cell adhesion molecules Ng-CAM/L1/NILE and N-CAM, and inhibits neuronal adhesion and neurite outgrowth.
7490074 1995 Structure and chromosomal localization of the mouse neurocan gene.
1326557 1992 Cloning and primary structure of neurocan, a developmentally regulated, aggregating chondroitin sulfate proteoglycan of brain.