Property Summary

NCBI Gene PubMed Count 13
PubMed Score 18.29
PubTator Score 20.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-03
glioblastoma -1.800 2.3e-05
sonic hedgehog group medulloblastoma -2.600 5.1e-09
atypical teratoid/rhabdoid tumor -2.300 4.2e-14
medulloblastoma, large-cell -2.000 2.6e-05
primitive neuroectodermal tumor -1.600 1.5e-04
fibroadenoma -2.200 2.8e-02
pediatric high grade glioma -2.000 1.9e-08
pilocytic astrocytoma -1.500 1.8e-07
ductal carcinoma in situ -2.300 5.2e-04
invasive ductal carcinoma -2.000 1.8e-02
psoriasis -1.200 5.8e-25

Gene RIF (6)

PMID Text
26550943 Characterization and recombinant expression of the nat8l gene that codes for ANAT.
26511490 NAA is produced specifically in NSCLC tumors through NAT8L overexpression, and its extracellular secretion can be detected in blood
24246274 This study demonistrated that the human NAT8L gene related to reward dependence, a personality trait, and grey matter volume in the caudate nucleus in healthy subjects, suggesting that NAT8L might also affect human personality
24155240 Nat8l impacts on the brown adipogenic phenotype
21936773 The aim of the present study was to determine which regions of the protein are important for its catalytic activity and its subcellular localization.
19807691 Results indicated that NAT8L, but not NAT14, catalysed the synthesis of NAA from L-aspartate and acetyl-CoA.

AA Sequence

MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPVAQPHGGAGGA      1 - 70
GPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCL     71 - 140
VPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVEL    141 - 210
LRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTL    211 - 280
SLAERLFFQVRYHRYRLQLREE                                                    281 - 302
//

Text Mined References (16)

PMID Year Title
26550943 2016 Purification and characterization of aspartate N-acetyltransferase: A critical enzyme in brain metabolism.
26511490 2016 Cancer-Specific Production of N-Acetylaspartate via NAT8L Overexpression in Non-Small Cell Lung Cancer and Its Potential as a Circulating Biomarker.
24246274 2014 Deletion of SHATI/NAT8L increases dopamine D1 receptor on the cell surface in the nucleus accumbens, accelerating methamphetamine dependence.
24155240 2013 NAT8L (N-acetyltransferase 8-like) accelerates lipid turnover and increases energy expenditure in brown adipocytes.
24105954 2013 SHATI/NAT8L regulates neurite outgrowth via microtubule stabilization.
21936773 2012 Determinants of the enzymatic activity and the subcellular localization of aspartate N-acetyltransferase.
20643647 2010 Molecular characterization of N-acetylaspartylglutamate synthetase.
20385109 2010 Methamphetamine-induced neuronal protein NAT8L is the NAA biosynthetic enzyme: implications for specialized acetyl coenzyme A metabolism in the CNS.
19807691 2009 Molecular identification of aspartate N-acetyltransferase and its mutation in hypoacetylaspartia.
19524112 2009 Evidence for mitochondrial and cytoplasmic N-acetylaspartate synthesis in SH-SY5Y neuroblastoma cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11397015 2001 Overexpression of camello, a member of a novel protein family, reduces blastomere adhesion and inhibits gastrulation in Xenopus laevis.