Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.25
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.8e-15
Astrocytoma, Pilocytic 3081 5.6e-06

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 5.6e-06
psoriasis -3.400 3.8e-15

AA Sequence

MKLEASCGTATSEVPKPEKKTARDAEPSSETRPQEVEAEPRSGSGPEAEAEPLDFVVATEREFEEVLAIS      1 - 70
GGIYGGLDYLPSRYHSWLRDPDRTVVLAKRNGGVIALESVNVIDAGETVLVEGLRVAPWERGKGVAGLLQ     71 - 140
RFCSQLVKRQHPGVKVARLTRDDQLGPRELKKYRLITKQGILLVRFNASALLAGLGARLAALRTSGTFSP    141 - 210
LPTEAVSEAGGDVARLLLSPSVQRDVLPGGTIIQDWQPYRPSESNLRLLAAKGLEWRVDSRARPRVLTLC    211 - 280
TRPFPIPHGGDGTWRYLNIDAFGSDGAQVQSQLLWHLQRQAPRLVGLNVMCQLFLEPQLWSQLADFCQVG    281 - 350
LGLELVKGYTEQYLLEADI                                                       351 - 369
//

Text Mined References (7)

PMID Year Title