Property Summary

NCBI Gene PubMed Count 30
PubMed Score 61.52
PubTator Score 38.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
acute quadriplegic myopathy 1158 4.5e-09
ovarian cancer 8520 8.0e-07
lung cancer 4740 1.0e-04
colon cancer 1478 1.4e-04
psoriasis 6694 5.0e-04
medulloblastoma, large-cell 6241 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Right atrial isomerism 29 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.104 4.5e-09
colon cancer 1.200 1.4e-04
lung cancer 1.600 1.0e-04
medulloblastoma, large-cell 1.100 2.5e-03
ovarian cancer 1.600 8.0e-07
psoriasis 1.100 5.0e-04

Gene RIF (14)

AA Sequence

MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYKKELGFSSHRK      1 - 70
KRMRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGMCVLQDFEALTPNLLARTVET     71 - 140
VEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPIS    141 - 210
SHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTV    211 - 280
ALTAARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPE    281 - 350
FNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTG    351 - 420
RSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCL    421 - 490
NITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLL    491 - 560
PPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIA    561 - 630
VHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNE    631 - 700
RPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKD    701 - 770
FRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMD    771 - 840
MIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQ    841 - 910
EKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAG    911 - 980
PNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK                             981 - 1025
//

Text Mined References (35)

PMID Year Title