Property Summary

NCBI Gene PubMed Count 15
PubMed Score 95.94
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.300 1.2e-02
diabetes mellitus -1.300 1.6e-03
Multiple myeloma 1.418 8.4e-03
ovarian cancer -1.200 1.2e-04
psoriasis 1.400 1.9e-04
Subcutaneous panniculitis-like T-cell ly... 1.900 4.5e-02
Waldenstrons macroglobulinemia 1.915 1.9e-03

Gene RIF (3)

AA Sequence

MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMW      1 - 70
HREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQ     71 - 140
GKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGL    141 - 210
APAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEG    211 - 280
GATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDL    281 - 350
LNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIP    351 - 420
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYK    421 - 490
REGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP                491 - 548
//

Text Mined References (26)

PMID Year Title