Property Summary

NCBI Gene PubMed Count 38
PubMed Score 86.66
PubTator Score 141.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 1.9e-03
acute myeloid leukemia 785 8.8e-03
Disease Target Count Z-score Confidence
Hydrocephalus 60 3.792 1.9
Tetanus 66 3.376 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 1.9e-03
acute myeloid leukemia 1.200 8.8e-03

Gene RIF (9)

PMID Text
26156199 alphaSNAP is mainly expressed in the neuron brain tissue of patients with temporal lobe epilepsy. Its blood levels were significantly lower in these patients. alphaSNAP levels may increase epilepsy susceptibility.
24311785 data implicates beta1 integrin, FAK, and paxillin in mediating the observed pro-adhesive effects of alphaSNAP. These results reveal novel roles for alphaSNAP in regulating ECM adhesion and motility of epithelial cells.
23187805 Study revealed a novel role for alphaSNAP as a negative regulator of autophagy that acts by enhancing mTOR signaling and regulating the integrity of the Golgi complex.
22485163 novel roles for alphaSNAP in promoting the formation of epithelial adherens junctions and tight junctions by controlling golgi-dependent expression and trafficking of junctional proteins.
22194596 a novel role for alphaSNAP in promoting epithelial cell survival by unique mechanisms involving regulation of Bcl-2 expression and Golgi biogenesis
21931730 The most N-terminal part of BKV agnoprotein is involved in the interaction with alpha-SNAP
20089838 Results suggest that the combinational SNARE proteins VAMP8 and Vti1b mediate the fusion of antimicrobial and canonical autophagosomes with lysosomes, an essential event for autophagic degradation.
15980433 G alpha12 interaction with alphaSNAP induces VE-cadherin localization at endothelial junctions and regulates barrier function
15542541 alpha-SNAP plays a key role in the acrosome reaction.

AA Sequence

MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQ      1 - 70
LHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEK     71 - 140
AIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAA    141 - 210
LCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML    211 - 280
LRIKKTIQGDEEDLR                                                           281 - 295
//

Text Mined References (44)

PMID Year Title
26156199 2015 Association of Alpha-Soluble NSF Attachment Protein with Epileptic Seizure.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24311785 2014 N-ethylmaleimide-sensitive factor attachment protein ? (?SNAP) regulates matrix adhesion and integrin processing in human epithelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23187805 2012 Loss of a membrane trafficking protein ?SNAP induces non-canonical autophagy in human epithelia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22485163 2012 A membrane fusion protein ?SNAP is a novel regulator of epithelial apical junctions.
22194596 2012 Loss of soluble N-ethylmaleimide-sensitive factor attachment protein ? (?SNAP) induces epithelial cell apoptosis via down-regulation of Bcl-2 expression and disruption of the Golgi.
21931730 2011 BKV agnoprotein interacts with ?-soluble N-ethylmaleimide-sensitive fusion attachment protein, and negatively influences transport of VSVG-EGFP.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
20089838 2010 Combinational soluble N-ethylmaleimide-sensitive factor attachment protein receptor proteins VAMP8 and Vti1b mediate fusion of antimicrobial and canonical autophagosomes with lysosomes.
19946888 2010 Defining the membrane proteome of NK cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16354670 2006 Involvement of a novel Q-SNARE, D12, in quality control of the endomembrane system.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15980433 2005 G alpha12 interaction with alphaSNAP induces VE-cadherin localization at endothelial junctions and regulates barrier function.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15542541 2005 alpha-SNAP and NSF are required in a priming step during the human sperm acrosome reaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322554 2004 Control of vesicle fusion by a tyrosine phosphatase.
15272311 2004 Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion.
15029241 2004 Implication of ZW10 in membrane trafficking between the endoplasmic reticulum and Golgi.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10683148 2000 Preferential association of syntaxin 8 with the early endosome.
10075705 1999 alpha-soluble N-ethylmaleimide-sensitive factor attachment protein is expressed in pancreatic beta cells and functions in insulin but not gamma-aminobutyric acid secretion.
9817754 1998 Syntaxin 13 mediates cycling of plasma membrane proteins via tubulovesicular recycling endosomes.
9697855 1998 The AMPA receptor GluR2 C terminus can mediate a reversible, ATP-dependent interaction with NSF and alpha- and beta-SNAPs.
9614193 1998 Endobrevin, a novel synaptobrevin/VAMP-like protein preferentially associated with the early endosome.
9507000 1998 Syntaxin 12, a member of the syntaxin family localized to the endosome.
9417091 1998 Syntaxin 7, a novel syntaxin member associated with the early endosomal compartment.
9362506 1997 Stimulation of NSF ATPase activity by alpha-SNAP is required for SNARE complex disassembly and exocytosis.
9349823 1997 A SNARE involved in protein transport through the Golgi apparatus.
9325254 1997 N-Ethylmaleimide-sensitive factor (NSF) and alpha-soluble NSF attachment proteins (SNAP) mediate dissociation of GS28-syntaxin 5 Golgi SNAP receptors (SNARE) complex.
9269766 1997 Regulated secretion in platelets: identification of elements of the platelet exocytosis machinery.
8455721 1993 SNAP family of NSF attachment proteins includes a brain-specific isoform.
1601890 1992 Soluble N-ethylmaleimide-sensitive fusion attachment proteins (SNAPs) bind to a multi-SNAP receptor complex in Golgi membranes.
1315316 1992 A multisubunit particle implicated in membrane fusion.