Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.05
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.7e-03
intraductal papillary-mucinous carcinoma... 1.100 8.2e-04
intraductal papillary-mucinous neoplasm ... 1.300 3.3e-03
lung cancer 1.200 1.3e-03
osteosarcoma -1.327 4.5e-06
ovarian cancer 1.100 6.7e-04

Gene RIF (10)

AA Sequence

MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINAL      1 - 70
KQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSK     71 - 140
VVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHF    141 - 210
EPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTI    211 - 280
TKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGE    281 - 350
EGEEEELEGDEEGEDEDDAEINPKV                                                 351 - 375
//

Text Mined References (31)

PMID Year Title