Property Summary

NCBI Gene PubMed Count 32
PubMed Score 11.86
PubTator Score 142.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.187 2.6e-02
Multiple myeloma 1.856 1.9e-04
astrocytic glioma -1.600 8.8e-03
ependymoma -1.700 4.3e-02
oligodendroglioma -1.600 3.8e-02
psoriasis -1.800 1.1e-04
glioblastoma -1.600 1.0e-03
osteosarcoma -1.193 2.1e-03
medulloblastoma -1.600 7.0e-06
atypical teratoid / rhabdoid tumor -1.800 2.9e-05
medulloblastoma, large-cell -1.500 7.8e-04
autosomal dominant Emery-Dreifuss muscul... 1.106 1.7e-03
Amyotrophic Lateral Sclerosis 1.059 1.2e-06
acute quadriplegic myopathy 1.544 3.3e-07
active Crohn's disease 1.112 1.2e-02
Breast cancer 4.100 2.6e-02
adult high grade glioma -1.400 8.6e-04
lung adenocarcinoma -1.200 2.3e-07
nasopharyngeal carcinoma 1.100 5.3e-03
gastric carcinoma 1.100 1.7e-02
ulcerative colitis 1.100 3.6e-04
ovarian cancer -2.000 1.0e-05

Gene RIF (13)

PMID Text
24798879 Nap1 binds to RAD54.
23691099 TAF-Ibeta promotes BZLF1 expression and subsequent lytic infection by affecting chromatin at the BZLF1 promoter
22174317 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
22134777 NAP1L1 was down-expressed following antiproliferative agent treatment in AuL12-treated cells in comparison with control and with Au(2)Phen-treated ovarian cancer cells.
21333655 Results identified several proteins interacting with NAP1L2, including the ubiquitously expressed members of the nucleosome assembly protein family, NAP1L1 and NAP1L4.
20002496 The biochemical properties of two human NAP1-like proteins, hNAP1L1 and hNAP1L4, were characterized.
19888548 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
19884766 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
19339032 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
18226242 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
17339334 Data show that Alien binds in vivo and in vitro to NAP1 and modulates its activity by enhancing NAP1-mediated nucleosome assembly on DNA.
16287874 both the acidic nature of nucleosome assembly protein I and its other functional structure(s) may be essential to mediate the assembly and disassembly of the dimers in nucleosome core particles
14966293 These results suggest that the binding of sequence-specific DNA binding proteins to human nucleosome assembly protein 1 may be an important step contributing to the activation of transcription.

AA Sequence

MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL      1 - 70
PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED     71 - 140
EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM    141 - 210
SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK    211 - 280
GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD    281 - 350
DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ                                 351 - 391
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24798879 2014 Nap1 stimulates homologous recombination by RAD51 and RAD54 in higher-ordered chromatin containing histone H1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23691099 2013 A role for the nucleosome assembly proteins TAF-I? and NAP1 in the activation of BZLF1 expression and Epstein-Barr virus reactivation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22134777 2012 2D-DIGE analysis of ovarian cancer cell responses to cytotoxic gold compounds.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21333655 2011 Interaction between nucleosome assembly protein 1-like family members.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20002496 2010 Functional characterization of human nucleosome assembly protein 1-like proteins as histone chaperones.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18331838 2008 TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1.
18226242 2008 The histone chaperone protein Nucleosome Assembly Protein-1 (hNAP-1) binds HIV-1 Tat and promotes viral transcription.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17339334 2007 The nucleosome assembly activity of NAP1 is enhanced by Alien.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16287874 2005 Assembly and disassembly of nucleosome core particles containing histone variants by human nucleosome assembly protein I.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15308774 2004 A tagging-via-substrate technology for detection and proteomics of farnesylated proteins.
14966293 2004 Direct interaction between nucleosome assembly protein 1 and the papillomavirus E2 proteins involved in activation of transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11940655 2002 Dual roles of p300 in chromatin assembly and transcriptional activation in cooperation with nucleosome assembly protein 1 in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8297347 1994 Molecular characterization of hNRP, a cDNA encoding a human nucleosome-assembly-protein-I-related gene product involved in the induction of cell proliferation.
7821789 1994 Construction of a human full-length cDNA bank.