Property Summary

NCBI Gene PubMed Count 45
PubMed Score 67.95
PubTator Score 49.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.500 2.6e-07
psoriasis 1.200 3.5e-03
osteosarcoma 1.689 7.5e-07
atypical teratoid / rhabdoid tumor 1.400 5.2e-04

 GWAS Trait (1)

Pathway (1)

Protein-protein Interaction (7)

Gene RIF (28)

PMID Text
26883114 This study confirms that meningeal Meningeal solitary fibrous tumor and hemangiopericytoma represent a histopathologic continuum linked by STAT6 nuclear expression and NAB2-STAT6 fusion similar to their soft tissue counterparts.
26817999 Case Report: NAB2-STAT6 fusion in glioblastoma.
26686340 the majority of intrathoracic SFTs exhibited STAT6 nuclear staining, and NAB2ex4-STAT6ex2/3 was the predominant fusion type.
26226844 We delineate the common and rare NAB2-STAT6 fusion variants in solitary fibrous tumors
26136329 also identified NAB2-STAT6 fusions in two hemangiopericytomas diagnosed in the past with a common variant of NAB2ex6-STAT6ex16/17
25893823 It is associated with local recurrence and late distance metastasis of brain tumors to extracranial sites.
25667482 reverse transcriptase PCR analysis identified a nerve growth factor inducible-A binding protein 2-STAT6 gene fusion. Our case supports the utility of STAT6 immunohistochemistry as an adjunct in the diagnosis of soft-tissue SFT with loss of CD34 positivity
25582503 There was no association between solitary fibrous tumors with either NAB2 exon 4-STAT6 exon 2 or 3 fusion and tumors with other fusions regarding the frequency of mutations in the examined genes (P = .201).
25554652 This study validated the existence of the NAB2-STAT6 fusion gene in solitary fibrous tumors and examined its relation with pathological features.
24513261 Tumors with the most common fusion variant, NAB2ex4-STAT6ex2/3, corresponded to classic pleuropulmonary solitary fibrous tumors with diffuse fibrosis and mostly benign behavior and occurred in older patients
23761323 44 SFTs were studied to identify pathogenetically important genetic rearrangements. RT-PCR analysis identified a NAB2/STAT6 fusion in 37/41 cases.
23575898 Meningeal hemangiopericytoma and solitary fibrous tumors carry the NAB2-STAT6 fusion
23416169 NAB2 and EGR-1 exert opposite roles in regulating TRAIL expression in human Natural Killer cells.
23313954 A NAB2-STAT6 fusion is a distinct molecular feature of solitary fibrous tumors.
23313952 A gene fusion of the transcriptional repressor NAB2 with the transcriptional activator STAT6 is the defining driver mutation of solitary fibrous tumor.
22431919 p130Cas signaling induces the expression of EGR1 and NAB2
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20506119 Results suggest that in many cells of neuroectodermal and epithelial origin EGR1, EGR2, and EGR3 activate NAB2 transcription which is in turn repressed by NAB2, thus establishing a negative feedback loop.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19888474 Nab2 is a novel endogenous negative regulator of Egr-1-dependent TGF-beta signaling responsible for setting the intensity of fibrotic responses
19460752 Knockdown of NGFI-A binding protein 2 (NAB2; EGR1 binding protein 2; MADER) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19423540 Observational study of gene-disease association. (HuGE Navigator)
16260776 Egr-1 induces the expression of its corepressor nab2 by activation of the nab2 promoter in a negative feedback loop
12427750 inhibits vascular endothelial growth factor-mediated gene induction and angiogenic responses of endothelial cells.
12030330 mutations in the human NAB2 gene are most likely not involved in the pathogenesis of peripheral neuropathies.

AA Sequence

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQ      1 - 70
QLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGS     71 - 140
MSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSP    141 - 210
PAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGH    211 - 280
IFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQV    281 - 350
ARESTYLSSLKGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL    351 - 420
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAE    421 - 490
FEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ                                       491 - 525
//

Text Mined References (53)

PMID Year Title
26883114 2016 NAB2-STAT6 Gene Fusion in Meningeal Hemangiopericytoma and Solitary Fibrous Tumor.
26817999 2016 Case Report: Next generation sequencing identifies a NAB2-STAT6 fusion in Glioblastoma.
26686340 2016 The clinicopathological significance of NAB2-STAT6 gene fusions in 52 cases of intrathoracic solitary fibrous tumors.
26226844 2015 NAB2-STAT6 fusion types account for clinicopathological variations in solitary fibrous tumors.
26136329 2015 [Two Cases of Primary Intracranial Solitary Fibrous Tumor:Genetic Examination of <i>NAB2-STAT6</i> Fusion and Its Association with Hemangiopericytoma].
25893823 2015 NAB2-STAT6 fusion gene analysis in two cases of meningeal solitary fibrous tumor/hemangiopericytoma with late distant metastases.
25667482 2015 FDG PET/CT and MR imaging of CD34-negative soft-tissue solitary fibrous tumor with NAB2-STAT6 fusion gene.
25582503 2015 Distinct clinicopathological features of NAB2-STAT6 fusion gene variants in solitary fibrous tumor with emphasis on the acquisition of highly malignant potential.
25554652 2015 Malignant solitary fibrous tumor with high-grade nuclear atypia: an alternate entity for the undetermined tumor group.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24513261 2014 Solitary fibrous tumors/hemangiopericytomas with different variants of the NAB2-STAT6 gene fusion are characterized by specific histomorphology and distinct clinicopathological features.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23834954 2013 Genome-wide association study of sensory disturbances in the inferior alveolar nerve after bilateral sagittal split ramus osteotomy.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23761323 2013 Comprehensive genetic analysis identifies a pathognomonic NAB2/STAT6 fusion gene, nonrandom secondary genomic imbalances, and a characteristic gene expression profile in solitary fibrous tumor.
23575898 2013 Meningeal hemangiopericytoma and solitary fibrous tumors carry the NAB2-STAT6 fusion and can be diagnosed by nuclear expression of STAT6 protein.
23416169 2013 NAB2 and EGR-1 exert opposite roles in regulating TRAIL expression in human Natural Killer cells.
23313954 2013 Whole-exome sequencing identifies a recurrent NAB2-STAT6 fusion in solitary fibrous tumors.
23313952 2013 Identification of recurrent NAB2-STAT6 gene fusions in solitary fibrous tumor by integrative sequencing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22431919 2012 Regulation of p130(Cas)/BCAR1 expression in tamoxifen-sensitive and tamoxifen-resistant breast cancer cells by EGR1 and NAB2.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
21836637 2011 The transcription factor Krox20 is an E3 ligase that sumoylates its Nab coregulators.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20506119 2010 EGR1, EGR2, and EGR3 activate the expression of their coregulator NAB2 establishing a negative feedback loop in cells of neuroectodermal and epithelial origin.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19888474 2009 The transcriptional cofactor nab2 is induced by tgf-Beta and suppresses fibroblast activation: physiological roles and impaired expression in scleroderma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16574654 2006 NAB2 represses transcription by interacting with the CHD4 subunit of the nucleosome remodeling and deacetylase (NuRD) complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260776 2005 Egr-1 induces the expression of its corepressor nab2 by activation of the nab2 promoter thereby establishing a negative feedback loop.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427750 2003 NAB2, a corepressor of EGR-1, inhibits vascular endothelial growth factor-mediated gene induction and angiogenic responses of endothelial cells.
12030330 2002 Search for mutations in the EGR2 corepressor proteins, NAB1 and NAB2, in human peripheral neuropathies.
11567222 2001 Frequent and early loss of the EGR1 corepressor NAB2 in human prostate carcinoma.
11135623 2001 Impaired prostate tumorigenesis in Egr1-deficient mice.
9774344 1998 Novel mutants of NAB corepressors enhance activation by Egr transactivators.
9722618 1998 The transcriptional corepressor NAB2 inhibits NGF-induced differentiation of PC12 cells.
9126479 1997 The Nab2 and Stat6 genes share a common transcription termination region.
8668170 1996 NAB2, a corepressor of NGFI-A (Egr-1) and Krox20, is induced by proliferative and differentiative stimuli.
8649813 1996 Mader: a novel nuclear protein over expressed in human melanomas.