Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.75
PubTator Score 3.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.700 1.6e-04
cutaneous lupus erythematosus 1.100 5.1e-04
osteosarcoma -1.218 3.7e-04
astrocytoma 1.100 4.7e-02
juvenile dermatomyositis 1.058 1.0e-11
tuberculosis and treatment for 3 months -1.400 2.7e-06
intraductal papillary-mucinous neoplasm ... 1.200 1.7e-02
lung adenocarcinoma -1.009 4.6e-06
spina bifida -1.011 3.4e-02
ovarian cancer -1.400 2.1e-05

Synonym

Accession O75113 A7MD49 Q2YDX1 N4BP1
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
24141722 The p34 interacts with the WW1 domain of NEDD4-1, an interaction that enhances NEDD4-1 stability.
19074885 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKEYIK      1 - 70
GICEPELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKL     71 - 140
FENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDS    141 - 210
QQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLTPDEEALSNER    211 - 280
ICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNIL    281 - 350
VNFFKTMGYSQEIVEKVIKVYGPSTEPLLLLEEIEKENKRFQEDREFSAGTVYPETNKTKNKGVYSSTNE    351 - 420
LTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETD    421 - 490
GLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKSACEKRLGCCSSPHSKPNCST    491 - 560
LSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAIT    561 - 630
HGLKKFFSCRGIAIAVEYFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERI    631 - 700
ASHDDRFLLHLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEF    701 - 770
LQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPSLQ    771 - 840
QNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQILVAHPYMKDLNALSAMVLD                  841 - 896
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141722 2014 p34 is a novel regulator of the oncogenic behavior of NEDD4-1 and PTEN.
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17592138 2007 The Nedd4-binding partner 1 (N4BP1) protein is an inhibitor of the E3 ligase Itch.
17114934 The NYN domains: novel predicted RNAses with a PIN domain-like fold.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11717310 2002 Identification of developmentally expressed proteins that functionally interact with Nedd4 ubiquitin ligase.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.