Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma -1.100 1.9e-02
intraductal papillary-mucinous adenoma (... -1.300 6.1e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.1e-03
ovarian cancer 1.300 7.1e-03
psoriasis 1.200 2.7e-04

Synonym

Accession Q6NZ67 Q96CG4
Symbols FAM128B
MOZART2B

Gene

  Ortholog (1)

Species Source Disease
OMA EggNOG

Gene RIF (2)

AA Sequence

MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPL      1 - 70
AVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSA     71 - 140
TRLPKGGGPGKSPTRGST                                                        141 - 158
//

Text Mined References (11)

PMID Year Title