Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.86
PubTator Score 16.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 2.300 2.2e-02
osteosarcoma -5.603 1.1e-14
periodontitis 2.700 1.2e-30
tuberculosis 2.400 2.5e-04
interstitial cystitis 4.000 6.4e-05
lung adenocarcinoma 1.300 1.2e-12
pancreatic carcinoma 2.300 2.2e-02
ulcerative colitis 3.300 5.0e-05
cystic fibrosis and chronic rhinosinusit... 1.215 1.3e-02
Chronic obstructive pulmonary disease -1.100 3.3e-02

Gene RIF (6)

PMID Text
24014023 miR-185 regulates T cell development through its targeting of several mRNAs including Mzb1.
23434460 results suggested that MGC29506 has the potential of functioning as a novel suppressor gene in gastric cancer
23189934 High expression of MZB1 predicts adverse prognosis in chronic lymphocytic leukemia, follicular lymphoma and diffuse large B-cell lymphoma and is associated with a unique gene expression signature.
22613335 Data show that proapoptotic caspase adapter protein PACAP is a potential serum marker of non-small cell lung cancer.
22573353 methylation-mediated silencing of MZB1 expression leads to loss of its tumor-suppressive activity, which may be a factor in hepatocarcinogenesis
12792799 MGC29506 gene, frequently down-regulated in intestinal-type gastric cancer, was found to encode secreted-type protein with six conserved cysteine residues [MGC29506]

AA Sequence

MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETK      1 - 70
LHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLS     71 - 140
RTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL                         141 - 189
//

Text Mined References (18)

PMID Year Title
24014023 2013 Transgenic expression of microRNA-185 causes a developmental arrest of T cells by targeting multiple genes including Mzb1.
23434460 2013 MGC29506 induces cell cycle arrest and is downregulated in gastric cancer.
23189934 2013 High expression of MZB1 predicts adverse prognosis in chronic lymphocytic leukemia, follicular lymphoma and diffuse large B-cell lymphoma and is associated with a unique gene expression signature.
22613335 2012 [Proteomics-based identification of proapoptotic caspase adapter protein as a novel serum marker of non-small cell lung cancer].
22573353 2012 Integrative array-based approach identifies MZB1 as a frequently methylated putative tumor suppressor in hepatocellular carcinoma.
21688198 2011 Novel hormone-regulated genes in visceral adipose tissue: cloning and identification of proinflammatory cytokine-like mouse and human MEDA-7: implications for obesity, insulin resistance and the metabolic syndrome.
21269460 2011 Initial characterization of the human central proteome.
21093319 2010 Mzb1 protein regulates calcium homeostasis, antibody secretion, and integrin activation in innate-like B cells.
19805157 2009 pERp1 is significantly up-regulated during plasma cell differentiation and contributes to the oxidative folding of immunoglobulin.
19805154 2009 Efficient IgM assembly and secretion require the plasma cell induced endoplasmic reticulum protein pERp1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12792799 2003 MGC29506 gene, frequently down-regulated in intestinal-type gastric cancer, encodes secreted-type protein with conserved cysteine residues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11350957 2001 Characterization of a novel proapoptotic caspase-2- and caspase-9-binding protein.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.