Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.77
PubTator Score 26.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -4.600 1.4e-04
posterior fossa group A ependymoma -6.500 4.2e-21
glioblastoma -5.600 4.9e-07
oligodendroglioma -2.700 5.6e-10
sonic hedgehog group medulloblastoma -2.200 6.6e-03
atypical teratoid / rhabdoid tumor -6.100 1.4e-07
medulloblastoma, large-cell -3.000 3.5e-05
pediatric high grade glioma -5.100 5.4e-09
pilocytic astrocytoma -5.300 2.2e-10
subependymal giant cell astrocytoma -4.682 3.4e-02
lung carcinoma 3.100 1.1e-42
Pick disease -1.800 1.4e-02
pituitary cancer 1.100 1.3e-02

Gene RIF (13)

PMID Text
25232846 Our data strongly strengthen the hypothesis that MYT1L is the causal gene for the observed syndromal intellectual disability.
24820620 Report shows that the first histidine of Cys2His2Cys domains is involved in a functionally important hydrogen bonding interaction.
24015200 MYT1L rs17039396 variants are associated with clinical outcome in gastric cancer.
23918370 Data indicate that reintroduction of A2BP1 or Myt1L in glioblastoma multiforme (GBM) cell lines and glioma stem cells profoundly inhibited tumorigenesis.
23061379 MYT1L and the SNTG2 genes within the reported region could probably relate to the phenotypic discordance of the monozygotic twins.
22547139 A meta-analysis of four recently published studies that together provide strong evidence for an association between variably sized microduplications involving the MYT1L gene and schizophrenia.
22157634 Results from this study indicate that the 2p25.3 duplication disrupting PXDN and MYT1L is a potential autism-causing variant in the pedigree reported here and should receive further consideration as a candidate for autism
21990140 MYT1L deletion gives a nonspecific clinical phenotype shared by patients with 2p25.3 deletions, with only intellectual disability and obesity/overweight being present in all patients.
21923761 Findings suggest that MYT1L may represent a susceptibility gene for schizophrenia in the Han Chinese population and show that a specific SNP may increase susceptibility in females.
21048971 results indicate that MYT1L may be a potential risk gene for major depressive disorder in the Chinese Han population
21048971 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18940311 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVDTEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKKRKTQDKQPQE      1 - 70
PAPKRKPFAVKADSSSVDECDDSDGTEDMDEKEEDEGEEYSEDNDEPGDEDEEDEEGDREEEEEIEEEDE     71 - 140
DDDEDGEDVEDEEEEEEEEEEEEEEEENEDHQMNCHNTRIMQDTEKDDNNNDEYDNYDELVAKSLLNLGK    141 - 210
IAEDAAYRARTESEMNSNTSNSLEDDSDKNENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENM    211 - 280
NDRNYADSMSQQDSRNMNYVMLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERN    281 - 350
PQQNMNIRQHVRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDDDTTSVNSDRS    351 - 420
EEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVKKP    421 - 490
YYGKDPSRTEKKESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHESVLKCPTPGCTGRGH    491 - 560
VNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSSQASDRVLRPMCFVKQLEIPQYGYRNNVPTTTP    561 - 630
RSNLAKELEKYSKTSFEYNSYDNHTYGKRAIAPKVQTRDISPKGYDDAKRYCKDPSPSSSSTSSYAPSSS    631 - 700
SNLSCGGGSSASSTCSKSSFDYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCATRNPDMEVDEN    701 - 770
GTLDLSMNKQRPRDSCCPILTPLEPMSPQQQAVMNNRCFQLGEGDCWDLPVDYTKMKPRRIDEDESKDIT    771 - 840
PEDLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSSQELKCPTPGC    841 - 910
DGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCDGQGHITGKYASHRSASGCPL    911 - 980
AAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGSFLTHRSLSGCPRATSAMKKAKLSGEQMLT    981 - 1050
IKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHE   1051 - 1120
LANLSQSLIHSLANIQLPHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV       1121 - 1186
//

Text Mined References (25)

PMID Year Title
25232846 2015 Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity.
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24820620 2014 A role for hydrogen bonding in DNA recognition by the non-classical CCHHC type zinc finger, NZF-1.
24015200 2013 Clinical significance of MYT1L gene polymorphisms in Chinese patients with gastric cancer.
23918370 2013 From the Cover: Neutralization of terminal differentiation in gliomagenesis.
23160955 2012 Multiplex targeted sequencing identifies recurrently mutated genes in autism spectrum disorders.
23061379 2013 Monozygotic twins discordant for submicroscopic chromosomal anomalies in 2p25.3 region detected by array CGH.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22547139 2012 Microduplications disrupting the MYT1L gene (2p25.3) are associated with schizophrenia.
22157634 2012 Germline mosaic transmission of a novel duplication of PXDN and MYT1L to two male half-siblings with autism.
21990140 2011 MYT1L is a candidate gene for intellectual disability in patients with 2p25.3 (2pter) deletions.
21923761 2012 Association study of myelin transcription factor 1-like polymorphisms with schizophrenia in Han Chinese population.
21617644 2011 Induction of human neuronal cells by defined transcription factors.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21048971 2010 Common SNPs in myelin transcription factor 1-like (MYT1L): association with major depressive disorder in the Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18940311 2008 Recurrent CNVs disrupt three candidate genes in schizophrenia patients.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9373037 1997 Myelin transcription factor 1 (Myt1) of the oligodendrocyte lineage, along with a closely related CCHC zinc finger, is expressed in developing neurons in the mammalian central nervous system.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.