Property Summary

NCBI Gene PubMed Count 9
PubMed Score 57.53
PubTator Score 7.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer -1.100 3.1e-02
atypical teratoid / rhabdoid tumor 1.100 6.4e-05
glioblastoma 1.200 8.2e-04
medulloblastoma 1.400 3.2e-03
medulloblastoma, large-cell 1.800 1.6e-05
hereditary spastic paraplegia -1.004 2.1e-02
juvenile dermatomyositis 1.070 1.7e-08
tuberculosis and treatment for 6 months 1.500 7.4e-04
Alzheimer's disease -1.400 2.7e-02
Pick disease -2.200 1.1e-06
progressive supranuclear palsy -1.500 2.1e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (4)

PMID Text
26220525 An in vivo genetic reversion highlights the crucial role of MYSM1 in human hematopoiesis and lymphocyte differentiation
24288411 the biallelic truncation of MYSM1 likely represents the cause of an inherited bone marrow failure syndrome in two siblings
17707232 The identification of histone H2A deubiquitinase (2A-DUB, or KIAA1915/MYSM1) specific for monoubiquitinated H2A (uH2A) that helps in delineating a strategy for specific regulatory pathways of gene activation, is reported.
17428495 The SWIRM structure of human MYb-like, Swirm and Mpn domain-containing protein-1 (MYSM1), is reported.

AA Sequence

MAAEEADVDIEGDVVAAAGAQPGSGENTASVLQKDHYLDSSWRTENGLIPWTLDNTISEENRAVIEKMLL      1 - 70
EEEYYLSKKSQPEKVWLDQKEDDKKYMKSLQKTAKIMVHSPTKPASYSVKWTIEEKELFEQGLAKFGRRW     71 - 140
TKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTKAWTPSCLRGRADPNLN    141 - 210
AVKIEKLSDDEEVDITDEVDELSSQTPQKNSSSDLLLDFPNSKMHETNQGEFITSDSQEALFSKSSRGCL    211 - 280
QNEKQDETLSSSEITLWTEKQSNGDKKSIELNDQKFNELIKNCNKHDGRGIIVDARQLPSPEPCEIQKNL    281 - 350
NDNEMLFHSCQMVEESHEEEELKPPEQEIEIDRNIIQEEEKQAIPEFFEGRQAKTPERYLKIRNYILDQW    351 - 420
EICKPKYLNKTSVRPGLKNCGDVNCIGRIHTYLELIGAINFGCEQAVYNRPQTVDKVRIRDRKDAVEAYQ    421 - 490
LAQRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLSAEELAKRREEEKGRPVKSLKVPRPTKSSFDPFQ    491 - 560
LIPCNFFSEEKQEPFQVKVASEALLIMDLHAHVSMAEVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQC    561 - 630
EMDPVSQTQASETLAVRGFSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGMIVSPYNRNNP    631 - 700
LPYSQITCLVISEEISPDGSYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRLSHSSVPMDKIFRRDSD    701 - 770
LTCLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENCTKELLM                771 - 828
//

Text Mined References (15)

PMID Year Title
26220525 2015 An in vivo genetic reversion highlights the crucial role of Myb-Like, SWIRM, and MPN domains 1 (MYSM1) in human hematopoiesis and lymphocyte differentiation.
24288411 2013 MYSM1 is mutated in a family with transient transfusion-dependent anemia, mild thrombocytopenia, and low NK- and B-cell counts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310492 2011 Genome-wide association study of diabetic retinopathy in a Taiwanese population.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17707232 2007 A histone H2A deubiquitinase complex coordinating histone acetylation and H1 dissociation in transcriptional regulation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17428495 2007 Structural and functional differences of SWIRM domain subtypes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.