Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.53
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.5e-16
group 3 medulloblastoma 4104 1.2e-04
subependymal giant cell astrocytoma 2287 1.3e-02
breast carcinoma 1638 4.7e-02
Disease Target Count Z-score Confidence
Spinal muscular atrophy 34 3.422 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.400 4.7e-02
ependymoma -1.300 4.5e-16
group 3 medulloblastoma -1.300 1.2e-04
subependymal giant cell astrocytoma -1.034 1.3e-02

AA Sequence

MASAAAGEAEETTRLRKPRFSFEENQILIREVRAHYPQLYGAQSRRVSVAERRRVWDGIAAKINGITSWK      1 - 70
RTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAILGPGVAAPGAGAGAEEPPAAP     71 - 140
SSQPPPPSACPQRYVLSEDRREDRRADTSAHSKAGSSSPEPWARPSCTPQEGGCPRPKERESPPPSALQP    141 - 210
VQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPPPRPPPTLSASDPSLDFLRAQQETANAIRELAGTL    211 - 280
RQGLAKLSEALSALLPLLPGTPVDSLPPPLPPPPPPPPPPRPVLPPPAPKVEITPEPVSVVAAVVDGAVV    281 - 350
AARGVIIAPRSEEGAPRPPPAPLPPHDSPPHKRRKGFPTRKRRGRWKSP                         351 - 399
//

Text Mined References (4)

PMID Year Title