Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.53
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma -1.400 2.8e-13
breast carcinoma 1.400 4.7e-02
group 3 medulloblastoma -1.300 1.2e-04
subependymal giant cell astrocytoma -1.034 1.3e-02

Synonym

Accession Q86VE0
Symbols P42pop

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASAAAGEAEETTRLRKPRFSFEENQILIREVRAHYPQLYGAQSRRVSVAERRRVWDGIAAKINGITSWK      1 - 70
RTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAILGPGVAAPGAGAGAEEPPAAP     71 - 140
SSQPPPPSACPQRYVLSEDRREDRRADTSAHSKAGSSSPEPWARPSCTPQEGGCPRPKERESPPPSALQP    141 - 210
VQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPPPRPPPTLSASDPSLDFLRAQQETANAIRELAGTL    211 - 280
RQGLAKLSEALSALLPLLPGTPVDSLPPPLPPPPPPPPPPRPVLPPPAPKVEITPEPVSVVAAVVDGAVV    281 - 350
AARGVIIAPRSEEGAPRPPPAPLPPHDSPPHKRRKGFPTRKRRGRWKSP                         351 - 399
//

Text Mined References (4)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15615774 2005 Profilin regulates the activity of p42POP, a novel Myb-related transcription factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.