Property Summary

NCBI Gene PubMed Count 53
PubMed Score 827.35
PubTator Score 61.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy 1.001 9.5e-05

Gene RIF (25)

AA Sequence

MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWAC      1 - 70
KVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN     71 - 140
QEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITV    141 - 210
EDVSVAFPDETMPN                                                            211 - 224
//

Text Mined References (54)

PMID Year Title