Property Summary

NCBI Gene PubMed Count 52
PubMed Score 772.01
PubTator Score 61.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy 1.001 9.5e-05

Protein-protein Interaction (7)

Gene RIF (25)

PMID Text
26563778 Findings indicate a interplay between A-kinase anchoring protein 6 (AKAP6) and myogenin.
25044114 results indicate that myogenin is a positive regulator in transcriptional regulation of MEGF10 in skeletal muscle
24577092 Sustained GSK3beta activity represses a critical regulatory step in the myogenic cascade, contributing to the undifferentiated, proliferative phenotype in alveolar rhabdomyosarcoma.
24215591 Data indicate that muscle MYOG mRNA expression doubled, whereas MSTN protein expression decreased following immobilization.
23944986 Our study illustrates that focal myogenin immunoreactivity occurs uncommonly in fibroepithelial polyps of the lower female genital tract.
23364797 the FACT complex promotes myogenin-dependent transcription
23226416 SREBP-1 regulate muscle protein synthesis through the downregulation of the expression of MYOD1, MYOG and MEF2C factors.
21672341 Human muscle samples were analysed at different time-points post-denervation to evaluate changes in myogenin expression and their relationship with skeletal muscle atrophy.
20213728 The physical interaction of CARM1 and PCAF is likely pivotal for the activation of PCAF in the downstream of CARM1 pathway for inducing myogenin under Tetradecanoylphorbol Acetate -induced differentiation.
19961777 After 2 years of denervation, expression of myogenin protein in myonuclei was decreased, but after 3 years of denervation, no expression of myogenin protein in myonuclei was found in denervated posterior cricoarytenoid muscles.
19470832 Decreased Jun-D and myogenin expression in muscle wasting of human cachexia.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19372547 Underexpression of myogenin is associated with liver metastases in rhabdomyosarcoma.
19095803 PAX3 mRNA is an Staufen 1-mediated mRNA decay target whose decay promotes myogenesis whereas myogenin mRNA is a classical nonsense-mediated mRNA decay target encoding a protein required for myogenesis
18708938 Diffuse myogenin expression by immunohistochemistry is an independent marker of poor survival in pediatric rhabdomyosarcoma.
18676376 NFAT and MyoD cooperation regulates myogenin expression and myogenesis
17531403 transcription of Cugbp1 gene in muscle is regulated by myogenin and E proteins
17468105 Both PCAF and BRG1 are also involved in the activation of the myogenin gene in rhabdomyosarcoma
17378694 MYOG had positive staining in this melanotic neuroectodermal tumor.
17378682 MYOG is a positive diagnostic for biliary tract rhabdomyosarcoma.
16614355 Myogenin and myogenic differentiation factor D (MyoD) mRNAs increased (P < 0.05) in young and old, whereas myogenic factor (myf)-5 mRNA increased in young only (P < 0.05). Myf-6 protein increased (P < 0.05) in both young and old.
16608842 there is a functional link between dysferlin and myogenin in the differentiation of skeletal muscle
15322112 induction of Id1 not only blocks transcriptional activity but also induces myogenin degradation by blocking formation of myogenin-E47 protein complexes.
15084602 myogenin and myocyte enhancer factor-2 expression are triggered by membrane hyperpolarization during human myoblast differentiation
14997318 study showed that a rapid rearrangement of myogenin expression occurs in exercised human skeletal muscles in response to a single bout of exercise

AA Sequence

MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWAC      1 - 70
KVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN     71 - 140
QEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITV    141 - 210
EDVSVAFPDETMPN                                                            211 - 224
//

Text Mined References (53)

PMID Year Title
26563778 2015 AKAP6 inhibition impairs myoblast differentiation and muscle regeneration: Positive loop between AKAP6 and myogenin.
25416956 2014 A proteome-scale map of the human interactome network.
25044114 2014 Myogenin is a positive regulator of MEGF10 expression in skeletal muscle.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
24577092 2014 Glycogen synthase kinase 3? represses MYOGENIN function in alveolar rhabdomyosarcoma.
24215591 2014 Muscle disuse atrophy is not accompanied by changes in skeletal muscle satellite cell content.
23944986 2013 Myogenin expression in vulvovaginal spindle cell lesions: analysis of a series of cases with an emphasis on diagnostic pitfalls.
23364797 2013 Myogenin recruits the histone chaperone facilitates chromatin transcription (FACT) to promote nucleosome disassembly at muscle-specific genes.
23226416 2012 SREBP-1 transcription factors regulate skeletal muscle cell size by controlling protein synthesis through myogenic regulatory factors.
21672341 2011 The study of myogenin expression in denervated human skeletal muscles.
20213728 2010 CARM1 activates myogenin gene via PCAF in the early differentiation of TPA-induced rhabdomyosarcoma-derived cells.
19961777 2009 [Correlation between myogenin and transforming growth factor-beta1 expression in long-term human denervated posterior cricoarytenoid muscles].
19783823 2009 SMYD1, the myogenic activator, is a direct target of serum response factor and myogenin.
19470832 2009 Decreased Jun-D and myogenin expression in muscle wasting of human cachexia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19372547 2009 Opposing control of rhabdomyosarcoma growth and differentiation by myogenin and interleukin 4.
19095803 2009 SMD and NMD are competitive pathways that contribute to myogenesis: effects on PAX3 and myogenin mRNAs.
18708938 2008 Diffuse myogenin expression by immunohistochemistry is an independent marker of poor survival in pediatric rhabdomyosarcoma: a tissue microarray study of 71 primary tumors including correlation with molecular phenotype.
18676376 2008 Cooperative synergy between NFAT and MyoD regulates myogenin expression and myogenesis.
17531403 2007 Regulation of the promoter of CUG triplet repeat binding protein, Cugbp1, during myogenesis.
17468105 2007 Sequential recruitment of PCAF and BRG1 contributes to myogenin activation in 12-O-tetradecanoylphorbol-13-acetate-induced early differentiation of rhabdomyosarcoma-derived cells.
17378694 Melanotic neuroectodermal tumor of infancy: report of a case with myogenic differentiation.
17378682 Distinguishing undifferentiated embryonal sarcoma of the liver from biliary tract rhabdomyosarcoma: a Children's Oncology Group study.
16614355 2006 Efficacy of 3 days/wk resistance training on myofiber hypertrophy and myogenic mechanisms in young vs. older adults.
16608842 2006 Absence of dysferlin alters myogenin expression and delays human muscle differentiation "in vitro".
16453911 1989 Corrigendum: Differential expression of myogenic determination genes in muscle cells: possible autoactivation by the Myf gene products.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322112 2004 Myogenin protein stability is decreased by BMP-2 through a mechanism implicating Id1.
15084602 2004 Membrane hyperpolarization triggers myogenin and myocyte enhancer factor-2 expression during human myoblast differentiation.
14997318 2004 Effects of one bout of endurance exercise on the expression of myogenin in human quadriceps muscle.
12716875 2003 Resistance exercise alters MRF and IGF-I mRNA content in human skeletal muscle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207009 2002 The alpha-like RNA polymerase II core subunit 3 (RPB3) is involved in tissue-specific transcription and muscle differentiation via interaction with the myogenic factor myogenin.
11076940 2001 Cloning of human acetyl-CoA carboxylase beta promoter and its regulation by muscle regulatory factors.
10757985 2000 A novel type of calmodulin interaction in the inhibition of basic helix-loop-helix transcription factors.
10471746 1999 A conserved motif N-terminal to the DNA-binding domains of myogenic bHLH transcription factors mediates cooperative DNA binding with pbx-Meis1/Prep1.
10329008 1999 Human bHLH transcription factor gene myogenin (MYOG): genomic sequence and negative mutation analysis in patients with severe congenital myopathies.
10082523 1999 Myogenic basic helix-loop-helix proteins and Sp1 interact as components of a multiprotein transcriptional complex required for activity of the human cardiac alpha-actin promoter.
9418854 1998 Multiple roles for the MyoD basic region in transmission of transcriptional activation signals and interaction with MEF2.
9242638 1997 Differential interactions of Id proteins with basic-helix-loop-helix transcription factors.
9234731 1997 Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD.
8797820 1996 I-mf, a novel myogenic repressor, interacts with members of the MyoD family.
8617811 1996 Physical interaction between the mitogen-responsive serum response factor and myogenic basic-helix-loop-helix proteins.
2583111 1989 Differential expression of myogenic determination genes in muscle cells: possible autoactivation by the Myf gene products.
2163343 1990 Myogenin resides in the nucleus and acquires high affinity for a conserved enhancer element on heterodimerization.
1962752 1990 Myogenin is in an evolutionarily conserved linkage group on human chromosome 1q31-q41 and unlinked to other mapped muscle regulatory factor genes.
1850513 1991 Human MyoD: cDNA and deduced amino acid sequence.
1846704 1991 The myoD gene family: nodal point during specification of the muscle cell lineage.
1659574 1991 Transcription of the muscle regulatory gene Myf4 is regulated by serum components, peptide growth factors and signaling pathways involving G proteins.
1649701 1991 Functional activity of myogenic HLH proteins requires hetero-oligomerization with E12/E47-like proteins in vivo.
1329097 1992 Cyclic amplification and selection of targets for multicomponent complexes: myogenin interacts with factors recognizing binding sites for basic helix-loop-helix, nuclear factor 1, myocyte-specific enhancer-binding factor 2, and COMP1 factor.
1325437 1992 Analysis of the oligomerization of myogenin and E2A products in vivo using a two-hybrid assay system.