Property Summary

NCBI Gene PubMed Count 124
PubMed Score 1281.50
PubTator Score 664.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.6e-02

Protein-protein Interaction (4)

Gene RIF (51)

PMID Text
26902638 The mechanism of bakuchiol-induced myogenesis is described.
26234681 these results suggest that sarcoma metastasis can be partially controlled through Pax7/MyoD-dependent activation of miR-182 and provide insight into the role that myogenic transcription factors have in sarcoma progression
25651906 These observations demonstrated the first time that Wnt3a can directly activate MyoD expression through targeting cis-elements in the DE and the L fragment.
25403490 MUNC is not a classic cis-acting enhancer RNA (e-RNA) acting exclusively by stimulating the neighboring MyoD gene
25108351 MyoD acts to promote SC proliferation and transition of cells into differentiation, while myogenin is known to drive terminal differentiation
25055037 MyoD was required for the induction of FGF21 gene transcription by mitochondrial dysfunction.
25002625 A recurring point mutation in MYOD1 is found in 10% of embryonal rhabdomyosarcomas with distinct clinical features and poor prognosis.
24905980 Studies indicate that MyoD occupies multiple promoters that induce the transcription of genes vital for establishing the myogenic fate and is also implicated as a mediator of many chromatin modifying enzymes for their recruitment to myogenic enhancers.
24824843 Spindle cell and sclerosing rhabdomyosarcoma show recurrent MYOD1 mutations, in keeping with a single pathologic entity, regardless of age at presentation.
24793135 analysis of a mutation in MYOD1 that may have a role in progression of embryonal rhabdomyosarcoma and may be associated with mutations altering PI3K-AKT pathway components
24272621 MYOD1 homozygous mutations are frequent, recurrent and pathognomonic events in adult-type spindle cell Rhabdomyosarcoma
24092238 Although expression of MyoD in a proliferating tumor is insufficient to prevent tumor progression, its expression in the cerebellum hinders medulloblastoma genesis.
23438194 Direct reprogramming of fibroblasts to myocytes via bacterial injection of MyoD protein.
23383201 CRABP2 promotes myoblast differentiation and is modulated by the transcription factors MyoD and Sp1 in C2C12 cells.
23230269 Using both primary human muscle cells and RD rhabdomyosarcoma cells, the study shows that MyoD binds in a similar genome-wide pattern in both tumor and normal cells but binds poorly at a subset of myogenic genes that fail to activate in the tumor cells.
23226416 SREBP-1 regulate muscle protein synthesis through the downregulation of the expression of MYOD1, MYOG and MEF2C factors.
22727434 MYOD1-transduced amnion-derived cells are capable of the dystrophin expression necessary for myogenic differentiation.
22621191 Human squamous cell carcinomas and malignant melanomas contain significantly more Myo/Nog cells than basal cell carcinomas.
22613845 results suggest that MyoD and TIP120B potentiate each other at gene expression and post-translation levels, respectively, which may promote myogenesis cooperatively
22591756 Promoter gene hypermethylation of the MYOD-1 gene increases significantly with age in normal individuals and thus may offer potential as a putative biomarker for colorectal cancer.
22277673 the involvement of HUWE1 in the ubiquitination and proteasomal degradation of MyoD was described.
22153073 Using MYOD1, study shows that an nucleosome-depleted region at the minimal enhancer region allows reprogramming to be initiated, which occurs in response to signals such as the forced expression of Myod1 in fibroblasts.
22068056 BAF60c-MyoD complex directs recruitment of SWI/SNF to muscle loci in response to differentiation cues.
21732495 Data demonstrate radical acceleration of iPSC creation with a fusion gene between Oct4 and the powerful transactivation domain (TAD) of MyoD.
21440539 The myofibroblasts demonstrate the capacity for de-differentiation and proliferation by modulation of endogenous levels of MyoD.
21326383 Increases in MYOD indicate that 1 week of conventional resistance exercise may increase myogenic activity, including satellite cell proliferation and differentiation, respectively, in younger men.
21321994 MyoD can play an active role in Alveolar rhabdomyosarcoma (ARMS)by augmenting Pax7-FKHR function.
20980337 Knockdown of MyoD and PEA3 attenuated MDR1 expression and increased the sensitivity of multidrug resistant cancer cells to cytotoxic drugs that were transported by P-gp in SGC7901/VCR cells.
20966410 Observational study of gene-disease association. (HuGE Navigator)
20716948 Mef2d, Six4, and p38alpha MAPK function coordinately as regulators of a master regulator to mediate expression of MyoD target genes.
20364308 MyoD and c-myb are involved in regulation of basal and estrogen-induced transcription activity of the BRCA1 gene
20333749 Transgenic Pax7 and MyoD are not essential for myogenic differentiation and participation of bone marrow-derived myogenic progenitors in muscle regeneration.
20139084 calpain 3 participates in the establishment of the pool of reserve cells by decreasing the transcriptional activity of the key myogenic regulator MyoD via proteolysis independently of the ubiquitin-proteasome degradation pathway.
19733896 The methylation of MYOD1 in the normal colonic mucosa was significantly correlated with K-ras mutation in neoplastic tissue arising from the mucosa.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19299559 multiple inhibitory mechanisms can be suppressed and myogenic differentiation can be induced in the RD rhabdomyosarcomas by increasing the abundance of MyoD:E-protein heterodimers
18676376 NFAT and MyoD cooperation regulates myogenin expression and myogenesis
18599480 a nonconventional interaction between HP1 and a tissue-specific transcription factor, MyoD. In addition, they strongly suggest that HP1 isoforms play important roles during muscle terminal differentiation in an isoform-dependent manner.
18078839 identified a negative regulatory element in the alpha-SG distal promoter including two conserved E-boxes (E1 and E2), which interact with MyoD
17693064 Expression of both the endogenous MyoD gene and a reporter gene driven by MyoD regulatory elements is similar in wild-type and homozygous null Gig1(nlacZ) transgenic MyoD1 mouse embryos.
17378682 MYOD1 is a positive diagnostic for biliary tract rhabdomyosarcoma.
17014844 MyoD below a threshold level and its displacement from the mitotic chromatin could present another window in the cell cycle for resetting the myogenic transcriptional program and to maintain the myogenic determination of the proliferating cells.
16841087 The results establish that cdk9/cyclin T2a-mediated coactivation of MyoD depends on serine 37 phosphorylation.
16614355 Myogenin and myogenic differentiation factor D (MyoD) mRNAs increased (P < 0.05) in young and old, whereas myogenic factor (myf)-5 mRNA increased in young only (P < 0.05). Myf-6 protein increased (P < 0.05) in both young and old.
16435141 The expression of MyoD1 was more sensitive but less specific in patients with rhabdomyosarcoma.
16099183 This review highlights studies of molecular mechanisms by which the muscle-specific myogenic basic helix-loop-helix protein MyoD interacts with other regulatory factors to coordinate gene expression in a controlled and ordered manner.
16007194 degradation is modulated by E12 and E47
15251938 Hypermethylation of MYOD1 is statistically significantly associated with poor disease outcome in cervical cancer.
15163661 MyoD modulates the rate of Id1 degradation and suggest a dynamic interplay of these factors
14767572 MYOD1 hypermethylation plays an important role in colorectal cancer and may be a novel prognostic factor.
12105204 The myogenic basic helix-loop-helix family of transcription factors, MyoD, Myf5, myogenin, and MRF4, can each activate the muscle differentiation program.

AA Sequence

MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVH      1 - 70
PAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNP     71 - 140
NQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGM    141 - 210
MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPP    211 - 280
RRQEAAAPSEGESSGDPTQSPDAAPQCPAGANPNPIYQVL                                  281 - 320
//

Text Mined References (129)

PMID Year Title
26902638 2016 Bakuchiol augments MyoD activation leading to enhanced myoblast differentiation.
26234681 2016 Myogenic transcription factors regulate pro-metastatic miR-182.
25651906 2015 Wnt3a signal pathways activate MyoD expression by targeting cis-elements inside and outside its distal enhancer.
25403490 2015 MUNC, a long noncoding RNA that facilitates the function of MyoD in skeletal myogenesis.
25108351 2014 The skeletal muscle satellite cell response to a single bout of resistance-type exercise is delayed with aging in men.
25055037 2014 FGF21 expression and release in muscle cells: involvement of MyoD and regulation by mitochondria-driven signalling.
25002625 2014 A MYOD1 mutation cooperates with PI3K pathway activation in ERMS.
24905980 2014 Activation of muscle enhancers by MyoD and epigenetic modifiers.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
24824843 2014 Recurrent MYOD1 mutations in pediatric and adult sclerosing and spindle cell rhabdomyosarcomas: evidence for a common pathogenesis.
24793135 2014 A recurrent neomorphic mutation in MYOD1 defines a clinically aggressive subset of embryonal rhabdomyosarcoma associated with PI3K-AKT pathway mutations.
24272621 2014 Transactivating mutation of the MYOD1 gene is a frequent event in adult spindle cell rhabdomyosarcoma.
24092238 2013 MyoD is a tumor suppressor gene in medulloblastoma.
23438194 2013 Direct reprogramming of fibroblasts to myocytes via bacterial injection of MyoD protein.
23383201 2013 CRABP2 promotes myoblast differentiation and is modulated by the transcription factors MyoD and Sp1 in C2C12 cells.
23230269 2013 Comparison of genome-wide binding of MyoD in normal human myogenic cells and rhabdomyosarcomas identifies regional and local suppression of promyogenic transcription factors.
23226416 2012 SREBP-1 transcription factors regulate skeletal muscle cell size by controlling protein synthesis through myogenic regulatory factors.
22727434 2013 Enhanced expression of myogenic differentiation factors and skeletal muscle proteins in human amnion-derived cells via the forced expression of MYOD1.
22621191 2012 Myo/Nog cells in normal, wounded and tumor-bearing skin.
22613845 2012 Interplay between two myogenesis-related proteins: TBP-interacting protein 120B and MyoD.
22591756 2012 MYOD-1 in normal colonic mucosa--role as a putative biomarker?
22277673 2012 HUWE1 ubiquitinates MyoD and targets it for proteasomal degradation.
22215600 2012 Lysine methyltransferase G9a methylates the transcription factor MyoD and regulates skeletal muscle differentiation.
22153073 2011 Polycomb-repressed genes have permissive enhancers that initiate reprogramming.
22068056 2012 Signal-dependent incorporation of MyoD-BAF60c into Brg1-based SWI/SNF chromatin-remodelling complex.
21732495 2011 Radical acceleration of nuclear reprogramming by chromatin remodeling with the transactivation domain of MyoD.
21440539 2011 Reversible differentiation of myofibroblasts by MyoD.
21326383 2011 Myogenic mRNA markers in young and old human skeletal muscle prior to and following sequential exercise bouts.
21321994 2011 Pax7-FKHR transcriptional activity is enhanced by transcriptionally repressed MyoD.
20980337 2010 Involvement of MyoD and PEA3 in regulation of transcription activity of MDR1 gene.
20966410 2010 Genomewide linkage and peakwide association analyses of carotid plaque in Caribbean Hispanics.
20716948 Regulating a master regulator: establishing tissue-specific gene expression in skeletal muscle.
20364308 2011 Involvement of MyoD and c-myb in regulation of basal and estrogen-induced transcription activity of the BRCA1 gene.
20333749 2010 Bone marrow-derived hematopoietic cells undergo myogenic differentiation following a Pax-7 independent pathway.
20139084 2010 Down-regulation of MyoD by calpain 3 promotes generation of reserve cells in C2C12 myoblasts.
19733896 2010 Methylation status of normal background mucosa is correlated with occurrence and development of neoplasia in the distal colon.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19299559 2009 MyoD and E-protein heterodimers switch rhabdomyosarcoma cells from an arrested myoblast phase to a differentiated state.
18676376 2008 Cooperative synergy between NFAT and MyoD regulates myogenin expression and myogenesis.
18599480 2008 Differential cooperation between heterochromatin protein HP1 isoforms and MyoD in myoblasts.
18078839 2008 Identification of two E-boxes that negatively modulate the activity of MyoD on the alpha-sarcoglycan core promoter.
17693064 Cloning and characterization of a novel MyoD enhancer-binding factor.
17378682 Distinguishing undifferentiated embryonal sarcoma of the liver from biliary tract rhabdomyosarcoma: a Children's Oncology Group study.
17014844 2006 MyoD undergoes a distinct G2/M-specific regulation in muscle cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16858404 2006 Histone methyltransferase Suv39h1 represses MyoD-stimulated myogenic differentiation.
16841087 2007 Abrogation of signal-dependent activation of the cdk9/cyclin T2a complex in human RD rhabdomyosarcoma cells.
16614355 2006 Efficacy of 3 days/wk resistance training on myofiber hypertrophy and myogenic mechanisms in young vs. older adults.
16435141 2006 Detection of bone marrow micrometastasis and microcirculating disease in rhabdomyosarcoma by a real-time RT-PCR assay.
16099183 MyoD and the transcriptional control of myogenesis.
16007194 2005 E12 and E47 modulate cellular localization and proteasome-mediated degradation of MyoD and Id1.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15251938 2004 Prognostic DNA methylation marker in serum of cancer patients.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15163661 2004 Ubiquitin-Proteasome-mediated degradation of Id1 is modulated by MyoD.
14767572 2004 Hypermethylation of the MYOD1 gene is a novel prognostic factor in patients with colorectal cancer.
12947115 2003 Reciprocal inhibition between MyoD and STAT3 in the regulation of growth and differentiation of myoblasts.
12887892 2003 Sir2 regulates skeletal muscle differentiation as a potential sensor of the redox state.
12716875 2003 Resistance exercise alters MRF and IGF-I mRNA content in human skeletal muscle.
12657651 2003 mSharp-1/DEC2, a basic helix-loop-helix protein functions as a transcriptional repressor of E box activity and Stra13 expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397066 2003 Determinants of nuclear and cytoplasmic ubiquitin-mediated degradation of MyoD.
12196028 2002 Analysis of the DNA-binding properties of MyoD, myogenin, and E12 by fluorescence anisotropy.
12105204 2002 The myogenic basic helix-loop-helix family of transcription factors shows similar requirements for SWI/SNF chromatin remodeling enzymes during muscle differentiation in culture.
12037670 2002 Activation of MyoD-dependent transcription by cdk9/cyclin T2.
11784080 2001 Sgn1, a basic helix-loop-helix transcription factor delineates the salivary gland duct cell lineage in mice.
11756408 2002 Modulation of basic helix-loop-helix transcription complex formation by Id proteins during neuronal differentiation.
11711431 2001 TGF-beta inhibits muscle differentiation through functional repression of myogenic transcription factors by Smad3.
11684023 2001 Class I histone deacetylases sequentially interact with MyoD and pRb during skeletal myogenesis.
11532390 2001 Control of muscle development by dueling HATs and HDACs.
11463815 2001 Interaction between acetylated MyoD and the bromodomain of CBP and/or p300.
11285237 2001 A role for histone deacetylase HDAC1 in modulating the transcriptional activity of MyoD: inhibition of the myogenic program.
11279181 2001 Regulation of myogenic terminal differentiation by the hairy-related transcription factor CHF2.
11076940 2001 Cloning of human acetyl-CoA carboxylase beta promoter and its regulation by muscle regulatory factors.
11025438 2000 Regulation of muscle regulatory factors by DNA-binding, interacting proteins, and post-transcriptional modifications.
10944526 2000 CREB-binding protein/p300 activates MyoD by acetylation.
10924525 2000 The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function.
10915743 2000 Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression.
10764802 2000 Stabilization of MyoD by direct binding to p57(Kip2).
10757985 2000 A novel type of calmodulin interaction in the inhibition of basic helix-loop-helix transcription factors.
10672515 1999 Expression and localisation of annexin VII (synexin) isoforms in differentiating myoblasts.
10619020 1999 Acetylation of MyoD directed by PCAF is necessary for the execution of the muscle program.
10601020 1999 Direct inhibition of G(1) cdk kinase activity by MyoD promotes myoblast cell cycle withdrawal and terminal differentiation.
10583555 1999 Primary alveolar soft part sarcoma of bone.
10471746 1999 A conserved motif N-terminal to the DNA-binding domains of myogenic bHLH transcription factors mediates cooperative DNA binding with pbx-Meis1/Prep1.
10406466 1999 The nuclear receptor corepressor N-CoR regulates differentiation: N-CoR directly interacts with MyoD.
10082523 1999 Myogenic basic helix-loop-helix proteins and Sp1 interact as components of a multiprotein transcriptional complex required for activity of the human cardiac alpha-actin promoter.
10022835 1999 Coupling of the cell cycle and myogenesis through the cyclin D1-dependent interaction of MyoD with cdk4.
9862959 1999 Exogenous expression of a dominant negative RORalpha1 vector in muscle cells impairs differentiation: RORalpha1 directly interacts with p300 and myoD.
9826778 1998 The orphan nuclear receptor, COUP-TF II, inhibits myogenesis by post-transcriptional regulation of MyoD function: COUP-TF II directly interacts with p300 and myoD.
9774340 1998 A novel site for ubiquitination: the N-terminal residue, and not internal lysines of MyoD, is essential for conjugation and degradation of the protein.
9710583 1998 Phosphorylation of nuclear MyoD is required for its rapid degradation.
9692544 1998 Retinoic acid receptors and muscle b-HLH proteins: partners in retinoid-induced myogenesis.
9659901 1997 Differential roles of p300 and PCAF acetyltransferases in muscle differentiation.
9546368 1998 Methylation alterations of the MyoD1 upstream region are predictive of subclassification of human rhabdomyosarcomas.
9482738 1998 The basic helix-loop-helix transcription factor Mist1 functions as a transcriptional repressor of myoD.
9418854 1998 Multiple roles for the MyoD basic region in transmission of transcriptional activation signals and interaction with MEF2.
9407021 1998 Levels of MyoD protein expression following injury of mdx and normal limb muscle are modified by thyroid hormone.
9343420 1997 The basic domain of myogenic basic helix-loop-helix (bHLH) proteins is the novel target for direct inhibition by another bHLH protein, Twist.
9242638 1997 Differential interactions of Id proteins with basic-helix-loop-helix transcription factors.
9238849 1997 The multifunctional role of the co-activator CBP in transcriptional regulation.
9235903 1997 Novel regulation of the helix-loop-helix protein Id1 by S5a, a subunit of the 26 S proteasome.
9234731 1997 Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD.
9184158 1997 MyoD-E12 heterodimers and MyoD-MyoD homodimers are equally stable.
9001254 1997 Molecular mechanisms of myogenic coactivation by p300: direct interaction with the activation domain of MyoD and with the MADS box of MEF2C.
9001211 1997 Mos activates myogenic differentiation by promoting heterodimerization of MyoD and E12 proteins.
8999959 1997 Physical and functional interactions between the transcriptional inhibitors Id3 and ITF-2b. Evidence toward a novel mechanism regulating muscle-specific gene expression.
8922385 1996 Preferential MyoD homodimer formation demonstrated by a general method of dominant negative mutation employing fusion with a lysosomal protease.
8759016 1996 E2A basic-helix-loop-helix transcription factors are negatively regulated by serum growth factors and by the Id3 protein.
8617811 1996 Physical interaction between the mitogen-responsive serum response factor and myogenic basic-helix-loop-helix proteins.
8576241 1996 Determinants of helix-loop-helix dimerization affinity. Random mutational analysis of SCL/tal.
8548800 1995 Cooperative activation of muscle gene expression by MEF2 and myogenic bHLH proteins.
8381715 1993 Interaction of myogenic factors and the retinoblastoma protein mediates muscle cell commitment and differentiation.
8380166 1993 Detection and modulation in vivo of helix-loop-helix protein-protein interactions.
3175662 1988 MyoD1: a nuclear phosphoprotein requiring a Myc homology region to convert fibroblasts to myoblasts.
2583111 1989 Differential expression of myogenic determination genes in muscle cells: possible autoactivation by the Myf gene products.
2550138 1989 MyoD is a sequence-specific DNA binding protein requiring a region of myc homology to bind to the muscle creatine kinase enhancer.
2315312 1990 Rhabdomyosarcoma-associated locus and MYOD1 are syntenic but separate loci on the short arm of human chromosome 11.
2253873 1990 MyoD family: a paradigm for development?
2176177 1990 The human MyoD1 (MYF3) gene maps on the short arm of chromosome 11 but is not associated with the WAGR locus or the region for the Beckwith-Wiedemann syndrome.
1850513 1991 Human MyoD: cDNA and deduced amino acid sequence.
1849142 1991 MyoD and the regulation of myogenesis by helix-loop-helix proteins.
1846704 1991 The myoD gene family: nodal point during specification of the muscle cell lineage.
1649701 1991 Functional activity of myogenic HLH proteins requires hetero-oligomerization with E12/E47-like proteins in vivo.
1406681 1992 Conformational activation of a basic helix-loop-helix protein (MyoD1) by the C-terminal region of murine HSP90 (HSP84).
1335366 1992 FGF inactivates myogenic helix-loop-helix proteins through phosphorylation of a conserved protein kinase C site in their DNA-binding domains.
1320026 1992 MyoD binds to the guanine tetrad nucleic acid structure.
1310896 1992 Functional antagonism between c-Jun and MyoD proteins: a direct physical association.