Property Summary

NCBI Gene PubMed Count 41
PubMed Score 87.18
PubTator Score 45.67

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (29)

PMID Text
26650627 Three novel genes were identified as recurrently mutated; MYCN, MYO5B and VCL, and mutations in these genes were exclusively found in malignant sympathetic paraganglioma tumors.
26553929 GLUT5 required an interaction cascade of Rab11, Myo5B, Slp4a, Munc18-2, and Vamp7 with Stx3.
25258405 Report changes in polarized signaling resulting from Myo5b loss-of-function mutations in microvillus inclusion disease.
24892806 Microvilli establishment required interaction between RAB8A and MYO5B, while loss of the interaction between RAB11A and MYO5B induced microvillus inclusions.
24413175 Part of the machinery for ezrin activation depends on recycling endosomes controlled by myosin Vb and Rab11a.
24375397 Cholestasis in microvillus inclusion disease results from impairment of the MYO5B/RAB11A apical recycling endosome pathway in hepatocytes, altered targeting of bile export pump to the canalicular membrane, and increased ileal bile acid absorption.
24373531 MYO5B-rs555879 is a risk factor for dyslexia in a German cohort.
24339992 Structural insights into the globular tails of the human type v myosins Myo5a, Myo5b, And Myo5c.
24248336 several crystal structures of the myosin Va or the myosin Vb globular tail domain that gives insights into how the motor is linked to the recycling membrane compartments via Rab11 or the melanophilin adaptor that binds to Rab27a.
24138727 Loss of MYO5b causes loss of apical microvilli, formation of inclusion bodies an protein trafficking defects in CaCo2 cells.
24097982 the cargo-binding domain (CBD) structures of the three human MyoV paralogs (Va, Vb, and Vc), revealing subtle structural changes that drive functional differentiation and a novel redox mechanism controlling the CBD dimerization process
23561489 The data of this study supported that the MYO5B gene might be associated with schizophrenia in the Chinese Han population.
23456500 MYO5B is epigenetically silenced in gastric cancer cells by DNA methylation and histone modification. Inactivation of MYO5B in gastric cancer cells expressing MYO5B inhibits HGF-stimulated MET degradation with sustained c-MET levels and signaling.
22441677 MYO5B mutations have divergent effects on the apical membrane system in kidney and intestinal epithelial cells.
22420646 Rab11A/myosin Vb/Rab11-FIP2 complex frames two late recycling steps of langerin from the ERC to the plasma membrane
22134786 Inactivation of MYO5B by siRNA against MYO5B can promote cell proliferation, invasion and motility.The expression of MYO5B was downregulated in gastric cancer and inactivation of MYO5B may contribute to tumorigenesis.
21282656 In polarized epithelial cyst cultures, Myo5B was required for apical membrane trafficking and de novo lumen formation, dependent on association with both Rab8a and Rab11a.
21206382 Our functional analysis indicates that MYO5B mutations can be correlated with an aberrant subcellular distribution of the myosin Vb protein, and apical recycling endosomes...
21199752 Molecular analysis of the MYO5B gene is helpful in genetic counseling and prenatal diagnosis of recurrent microvillus inclusion disease in subsequent pregnancies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20186687 15 novel nonsense and missense mutations in MYO5B in 11 unrelated microvillus inclusion disease patients;MYO5B mutations are a major cause of disease
19610025 Myosin Vb was present in nucleoli where it co-localises with RNA polymerase I, and newly synthesised ribosomal RNA. Vb was also found to physically associate with RNA polymerase I and actin in co-immunoprecipitation experiments.
19008234 related Rab protein, Rab10, can interact with myosin Va, myosin Vb, and myosin Vc
19006234 A shared homozygous mutation in MYO5B in seven affected Navajos with the expected heterozygosity in five parents, was identified.
18724368 MYO5B mutations cause microvillus inclusion disease and disrupt epithelial cell polarity.
18317468 Genome-wide association study of gene-disease association. (HuGE Navigator)
17462998 myosin Vb is required for CFTR recycling in Rab11a-specific apical recycling endosomes in polarized human airway epithelial cells
16214890 Data suggest that polarization of hepatocytes requires recruitment of rab11a and myosin Vb to intracellular membranes that contain apical ABC transporters and transcytotic markers.
11408590 Dominant negative approach suggests MYO5B plays a role in plasma membrane recycling (through early endosomes).

AA Sequence

MSVGELYSQCTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDETILEYPIDVQRNQLPFLRNPDILVG      1 - 70
ENDLTALSYLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYTYSGQNMGDMDPHIF     71 - 140
AVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSASETNIEEKVLASSPIMEAIGNAK    141 - 210
TTRNDNSSRFGKYIQIGFDKRYHIIGANMRTYLLEKSRVVFQADDERNYHIFYQLCAAAGLPEFKELALT    211 - 280
SAEDFFYTSQGGDTSIEGVDDAEDFEKTRQAFTLLGVKESHQMSIFKIIASILHLGSVAIQAERDGDSCS    281 - 350
ISPQDVYLSNFCRLLGVEHSQMEHWLCHRKLVTTSETYVKTMSLQQVINARNALAKHIYAQLFGWIVEHI    351 - 420
NKALHTSLKQHSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDF    421 - 490
YDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYDRHSSSQHFQKPRMSNTAFIIVHFADKVEYL    491 - 560
SDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDPVPATTPGKGSSSKISVRSARPPMKVSNKEHKK    561 - 630
TVGHQFRTSLHLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWAY    631 - 700
HDFFNRYRVLVKKRELANTDKKAICRSVLENLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFRTATIM    701 - 770
IQKTVRGWLQKVKYHRLKGATLTLQRYCRGHLARRLAEHLRRIRAAVVLQKHYRMQRARQAYQRVRRAAV    771 - 840
VIQAFTRAMFVRRTYRQVLMEHKATTIQKHVRGWMARRHFQRLRDAAIVIQCAFRMLKARRELKALRIEA    841 - 910
RSAEHLKRLNVGMENKVVQLQRKIDEQNKEFKTLSEQLSVTTSTYTMEVERLKKELVHYQQSPGEDTSLR    911 - 980
LQEEVESLRTELQRAHSERKILEDAHSREKDELRKRVADLEQENALLKDEKEQLNNQILCQSKDEFAQNS    981 - 1050
VKENLMKKELEEERSRYQNLVKEYSQLEQRYDNLRDEMTIIKQTPGHRRNPSNQSSLESDSNYPSISTSE   1051 - 1120
IGDTEDALQQVEEIGLEKAAMDMTVFLKLQKRVRELEQERKKLQVQLEKREQQDSKKVQAEPPQTDIDLD   1121 - 1190
PNADLAYNSLKRQELESENKKLKNDLNELRKAVADQATQNNSSHGSPDSYSLLLNQLKLAHEELEVRKEE   1191 - 1260
VLILRTQIVSADQRRLAGRNAEPNINARSSWPNSEKHVDQEDAIEAYHGVCQTNSKTEDWGYLNEDGELG   1261 - 1330
LAYQGLKQVARLLEAQLQAQSLEHEEEVEHLKAQLEALKEEMDKQQQTFCQTLLLSPEAQVEFGVQQEIS   1331 - 1400
RLTNENLDLKELVEKLEKNERKLKKQLKIYMKKAQDLEAAQALAQSERKRHELNRQVTVQRKEKDFQGML   1401 - 1470
EYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADYTNDDLKVHSLLTSTINGIKKVLKKHN   1471 - 1540
DDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIAE   1541 - 1610
GVLQPMIVSAMLENESIQGLSGVKPTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTVMCDQGLDPEIILQ   1611 - 1680
VFKQLFYMINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGAVQTMEPLIQAAQLLQLK   1681 - 1750
KKTQEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVAFIRTIQAQLQERNDPQQLLLDAKHMFPV   1751 - 1820
LFPFNPSSLTMDSIHIPACLNLEFLNEV                                             1821 - 1848
//

Text Mined References (47)

PMID Year Title
26650627 2016 Malignant pheochromocytomas/paragangliomas harbor mutations in transport and cell adhesion genes.
26553929 2015 Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
25416956 2014 A proteome-scale map of the human interactome network.
25258405 2014 Myosin 5b loss of function leads to defects in polarized signaling: implication for microvillus inclusion disease pathogenesis and treatment.
24892806 2014 Myosin Vb uncoupling from RAB8A and RAB11A elicits microvillus inclusion disease.
24413175 2014 Myosin Vb and Rab11a regulate phosphorylation of ezrin in enterocytes.
24375397 2014 MYO5B and bile salt export pump contribute to cholestatic liver disorder in microvillous inclusion disease.
24373531 2014 Genetic risk variants for dyslexia on chromosome 18 in a German cohort.
24339992 2013 Structural insights into the globular tails of the human type v myosins Myo5a, Myo5b, And Myo5c.
24248336 2013 Structural basis of myosin V Rab GTPase-dependent cargo recognition.
24138727 2014 Microvillus inclusion disease: loss of Myosin vb disrupts intracellular traffic and cell polarity.
24097982 2013 Structural insights into functional overlapping and differentiation among myosin V motors.
23561489 2013 Myosin Vb gene is associated with schizophrenia in Chinese Han population.
23456500 2013 MYO5B is epigenetically silenced and associated with MET signaling in human gastric cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22441677 2012 MYO5B mutations in patients with microvillus inclusion disease presenting with transient renal Fanconi syndrome.
22420646 2012 A Rab11A/myosin Vb/Rab11-FIP2 complex frames two late recycling steps of langerin from the ERC to the plasma membrane.
22134786 2012 Inactivation of MYO5B promotes invasion and motility in gastric cancer cells.
21282656 2011 Rab GTPase-Myo5B complexes control membrane recycling and epithelial polarization.
21206382 2011 Functional characterization of mutations in the myosin Vb gene associated with microvillus inclusion disease.
21199752 2010 Microvillus inclusion disease: prenatal ultrasound findings, molecular diagnosis and genetic counseling of congenital diarrhea.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20186687 2010 Loss-of-function of MYO5B is the main cause of microvillus inclusion disease: 15 novel mutations and a CaCo-2 RNAi cell model.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19610025 2009 Myosin Vb localises to nucleoli and associates with the RNA polymerase I transcription complex.
19542231 2009 Requirement of myosin Vb.Rab11a.Rab11-FIP2 complex in cholesterol-regulated translocation of NPC1L1 to the cell surface.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19008234 2009 Alternative splicing in class V myosins determines association with Rab10.
19006234 2008 Navajo microvillous inclusion disease is due to a mutation in MYO5B.
18724368 2008 MYO5B mutations cause microvillus inclusion disease and disrupt epithelial cell polarity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18317468 2008 Whole-genome association study of bipolar disorder.
17462998 2007 Myosin Vb is required for trafficking of the cystic fibrosis transmembrane conductance regulator in Rab11a-specific apical recycling endosomes in polarized human airway epithelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16214890 2005 Rab11a and myosin Vb are required for bile canalicular formation in WIF-B9 cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15772161 2005 CART: an Hrs/actinin-4/BERP/myosin V protein complex required for efficient receptor recycling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11495908 2001 Identification and characterization of a family of Rab11-interacting proteins.
11408590 2001 Myosin vb is associated with plasma membrane recycling systems.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
8884266 1996 Mapping of unconventional myosins in mouse and human.
8022818 1994 Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].
2236059 1990 Molecular cloning and amino acid sequence of brain L-glutamate decarboxylase.