Property Summary

NCBI Gene PubMed Count 31
PubMed Score 22.07
PubTator Score 8049.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 3.600 2.7e-09
psoriasis -2.700 1.4e-05
cutaneous lupus erythematosus -2.000 3.6e-03
osteosarcoma 1.205 2.1e-05
glioblastoma -1.100 2.0e-04
Multiple Sclerosis 2.400 1.2e-03
interstitial cystitis -1.200 8.9e-04
adult high grade glioma -1.300 4.3e-04
group 3 medulloblastoma -1.400 9.9e-03
pilocytic astrocytoma 1.100 3.6e-03
ovarian cancer 2.100 5.0e-12

Protein-protein Interaction (2)

Gene RIF (15)

PMID Text
26124132 phosphorylation of human cardiac myosin regulatory light chain prevents development of hypertrophic cardiomyopathy in mice
24072716 The data show that although NM IIA and IIB form filaments with similar properties, NM IIC forms filaments that are less well suited to roles such as tension maintenance within the cell.
23273769 Results support the hypothesis that there is another DFNA gene upstream of the MYH14 gene and it may be linked to the DFNA4 locus.
21872659 the alterations of the MYH14 gene may contribute to Myotonic dystrophy type 1 molecular pathogenesis.
21480433 A complex phenotype of peripheral neuropathy, myopathy, hoarseness, and hearing loss is linked to an autosomal dominant mutation in MYH14
21478157 kinetic and functional characterization of the motor domains of human nonmuscle myosin-2C isoforms
21368133 data identify CEACAM16 as an alpha-tectorin-interacting protein that concentrates at the point of attachment of the TM to the stereocilia and, when mutated, results in ADNSHL at the DFNA4 locus
20533261 Mutation in MYH14 gene can cause dominant non-syndromic hearing impairment in Asian population, suggesting that MYH14 gene can be a disease-causing gene of Chinese patients with hearing impairment.
19240025 the alternatively spliced isoform of non-muscle myosin II-C is not regulated by myosin light chain phosphorylation
19183343 One SNP in PCDH15 (rs7095441) and two SNPs in MYH14 (rs667907 and rs588035), resulted in significant associations in the Polish sample set and significant interactions with noise exposure level in the Swedish sample set.
18471249 data do not support the involvement of MYH14 in cleft lip and palate among the Italian population
18471249 Observational study of gene-disease association. (HuGE Navigator)
15845534 mutations and alternative splicing alter the enzymatic and motile activity of nonmuscle myosins II-B and II-C
15015131 mutational screening in a large series of 300 hearing-impaired patients from Italy, Spain, and Belgium and in a German kindred linked to DFNA4
8424456 HIV-1 protease cleaves human myosin heavy chain in vitro

AA Sequence

MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPSELHGFEAAAL      1 - 70
RDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNLRERYYSGLIYTYSGL     71 - 140
FCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKK    141 - 210
VIQYLAHVASSPKGRKEPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGAN    211 - 280
IETYLLEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLE    281 - 350
SLRVLGFSHEEIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRI    351 - 420
KVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIAGFEIFQLNSF    421 - 490
EQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWF    491 - 560
PKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQST    561 - 630
DRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNH    631 - 700
EKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQA    701 - 770
LELDPNLYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQQQQSALRVMQRNC    771 - 840
AAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQGRVAQLEEERARLA    841 - 910
EQLRAEAELCAEAEETRGRLAARKQELELVVSELEARVGEEEECSRQMQTEKKRLQQHIQELEAHLEAEE    911 - 980
GARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERKLLEDRLAEFSSQAAEEEEKVKSLNKLRLKYE    981 - 1050
ATIADMEDRLRKEEKGRQELEKLKRRLDGESSELQEQMVEQQQRAEELRAQLGRKEEELQAALARAEDEG   1051 - 1120
GARAQLLKSLREAQAALAEAQEDLESERVARTKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKRE   1121 - 1190
QEVTELKKTLEEETRIHEAAVQELRQRHGQALGELAEQLEQARRGKGAWEKTRLALEAEVSELRAELSSL   1191 - 1260
QTARQEGEQRRRRLELQLQEVQGRAGDGERARAEAAEKLQRAQAELENVSGALNEAESKTIRLSKELSST   1261 - 1330
EAQLHDAQELLQEETRAKLALGSRVRAMEAEAAGLREQLEEEAAARERAGRELQTAQAQLSEWRRRQEEE   1331 - 1400
AGALEAGEEARRRAAREAEALTQRLAEKTETVDRLERGRRRLQQELDDATMDLEQQRQLVSTLEKKQRKF   1401 - 1470
DQLLAEEKAAVLRAVEERERAEAEGREREARALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDV   1471 - 1540
GKSVHELERACRVAEQAANDLRAQVTELEDELTAAEDAKLRLEVTVQALKTQHERDLQGRDEAGEERRRQ   1541 - 1610
LAKQLRDAEVERDEERKQRTLAVAARKKLEGELEELKAQMASAGQGKEEAVKQLRKMQAQMKELWREVEE   1611 - 1680
TRTSREEIFSQNRESEKRLKGLEAEVLRLQEELAASDRARRQAQQDRDEMADEVANGNLSKAAILEEKRQ   1681 - 1750
LEGRLGQLEEELEEEQSNSELLNDRYRKLLLQVESLTTELSAERSFSAKAESGRQQLERQIQELRGRLGE   1751 - 1820
EDAGARARHKMTIAALESKLAQAEEQLEQETRERILSGKLVRRAEKRLKEVVLQVEEERRVADQLRDQLE   1821 - 1890
KGNLRVKQLKRQLEEAEEEASRAQAGRRRLQRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQV   1891 - 1960
FRLEEGVASDEEAEEAQPGSGPSPEPEGSPPAHPQ                                      1961 - 1995
//

Text Mined References (38)

PMID Year Title
26124132 2015 Constitutive phosphorylation of cardiac myosin regulatory light chain prevents development of hypertrophic cardiomyopathy in mice.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24072716 2013 Characterization of three full-length human nonmuscle myosin II paralogs.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23273769 2012 Clue to a new deafness gene: a large Chinese nonsyndromic hearing loss family linked to DFNA4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22993228 2013 Novel genetic variants associated with lumbar disc degeneration in northern Europeans: a meta-analysis of 4600 subjects.
21872659 2012 Aberrant splicing and expression of the non muscle myosin heavy-chain gene MYH14 in DM1 muscle tissues.
21480433 2011 A complex phenotype of peripheral neuropathy, myopathy, hoarseness, and hearing loss is linked to an autosomal dominant mutation in MYH14.
21478157 2011 Comparative kinetic and functional characterization of the motor domains of human nonmuscle myosin-2C isoforms.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21368133 2011 Carcinoembryonic antigen-related cell adhesion molecule 16 interacts with alpha-tectorin and is mutated in autosomal dominant hearing loss (DFNA4).
21269460 2011 Initial characterization of the human central proteome.
20533261 2010 [c.359T>C mutation of the MYH14 gene in two autosomal dominant non-syndromic hearing impairment families with common ancestor].
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240025 2009 An alternatively spliced isoform of non-muscle myosin II-C is not regulated by myosin light chain phosphorylation.
19183343 2009 Candidate gene association study for noise-induced hearing loss in two independent noise-exposed populations.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18471249 2008 Investigation of MYH14 as a candidate gene in cleft lip with or without cleft palate.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17940200 2007 Divergent evolution of the myosin heavy chain gene family in fish and tetrapods: evidence from comparative genomic analysis.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16222661 2005 Genetic heterogeneity of deafness phenotypes linked to DFNA4.
15845534 2005 Disease-associated mutations and alternative splicing alter the enzymatic and motile activity of nonmuscle myosins II-B and II-C.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
15015131 2004 Nonmuscle myosin heavy-chain gene MYH14 is expressed in cochlea and mutated in patients affected by autosomal dominant hearing impairment (DFNA4).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14594953 2004 Identification and characterization of nonmuscle myosin II-C, a new member of the myosin II family.
12909352 2003 A novel myosin heavy chain gene in human chromosome 19q13.3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11919279 2002 Evolutionary implications of three novel members of the human sarcomeric myosin heavy chain gene family.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
8022818 1994 Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.
7655461 1995 Linkage of a gene for dominant non-syndromic deafness to chromosome 19.