Property Summary

NCBI Gene PubMed Count 17
PubMed Score 106.86
PubTator Score 48.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.441 2.4e-05
diabetes mellitus -1.100 1.5e-02

Gene RIF (3)

PMID Text
19453261 Observational study of gene-disease association. (HuGE Navigator)
16614355 Myogenin and myogenic differentiation factor D (MyoD) mRNAs increased (P < 0.05) in young and old, whereas myogenic factor (myf)-5 mRNA increased in young only (P < 0.05). Myf-6 protein increased (P < 0.05) in both young and old.
12105204 The myogenic basic helix-loop-helix family of transcription factors, MyoD, Myf5, myogenin, and MRF4, can each activate the muscle differentiation program.

AA Sequence

MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQP      1 - 70
PHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISY     71 - 140
IERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDS    141 - 210
SASSSLRCLSSIVDSISSEERKLPCVEEVVEK                                          211 - 242
//

Text Mined References (18)

PMID Year Title
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
16614355 2006 Efficacy of 3 days/wk resistance training on myofiber hypertrophy and myogenic mechanisms in young vs. older adults.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12105204 2002 The myogenic basic helix-loop-helix family of transcription factors shows similar requirements for SWI/SNF chromatin remodeling enzymes during muscle differentiation in culture.
11368338 2001 Posttranscriptional regulation of human ADH5/FDH and Myf6 gene expression by upstream AUG codons.
11053684 2000 Heterozygous myogenic factor 6 mutation associated with myopathy and severe course of Becker muscular dystrophy.
10757985 2000 A novel type of calmodulin interaction in the inhibition of basic helix-loop-helix transcription factors.
9418854 1998 Multiple roles for the MyoD basic region in transmission of transcriptional activation signals and interaction with MEF2.
9242638 1997 Differential interactions of Id proteins with basic-helix-loop-helix transcription factors.
9234731 1997 Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD.
8978788 1996 Assignment of the human myogenic factors 5 and 6 (MYF5, MYF6) gene cluster to 12q21 by in situ hybridization and physical mapping of the locus between D12S350 and D12S106.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
2311584 1990 Myf-6, a new member of the human gene family of myogenic determination factors: evidence for a gene cluster on chromosome 12.
1945842 1991 The four human muscle regulatory helix-loop-helix proteins Myf3-Myf6 exhibit similar hetero-dimerization and DNA binding properties.