Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.65
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
cutaneous lupus erythematosus -2.600 4.8e-05
psoriasis -2.900 1.7e-04
osteosarcoma -1.423 1.9e-02
sonic hedgehog group medulloblastoma 1.400 1.1e-03
cystic fibrosis 1.591 1.4e-05
atypical teratoid / rhabdoid tumor 1.100 3.6e-03
glioblastoma -1.100 1.2e-02
medulloblastoma, large-cell 1.300 1.8e-03
primitive neuroectodermal tumor 1.600 7.5e-06
intraductal papillary-mucinous carcinoma... -1.500 1.6e-02
adult high grade glioma 1.100 2.8e-03
lung carcinoma 2.200 4.1e-34
Pick disease 1.400 2.1e-04
ductal carcinoma in situ 1.600 1.2e-02
invasive ductal carcinoma 1.600 1.1e-02
chronic rhinosinusitis -1.024 3.3e-02

Gene RIF (2)

PMID Text
20709755 RNA-binding protein Muscleblind-like 3 (MBNL3) disrupts myocyte enhancer factor 2 (Mef2) {beta}-exon splicing
18854154 Knockdown of myelin expression factor 2 (MYEF2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MADANKAEVPGATGGDSPHLQPAEPPGEPRREPHPAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEK      1 - 70
STGSKKANRFHPYSKDKNSGAGEKKGPNRNRVFISNIPYDMKWQAIKDLMREKVGEVTYVELFKDAEGKS     71 - 140
RGCGVVEFKDEEFVKKALETMNKYDLSGRPLNIKEDPDGENARRALQRTGGSFPGGHVPDMGSGLMNLPP    141 - 210
SILNNPNIPPEVISNLQAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMGTVTF    211 - 280
EQAIEAVQAISMFNGQFLFDRPMHVKMDDKSVPHEEYRSHDGKTPQLPRGLGGIGMGLGPGGQPISASQL    281 - 350
NIGGVMGNLGPGGMGMDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRG    351 - 420
DIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPG    421 - 490
IGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGK    491 - 560
SKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA                                  561 - 600
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20709755 2010 RNA-binding protein Muscleblind-like 3 (MBNL3) disrupts myocyte enhancer factor 2 (Mef2) {beta}-exon splicing.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
8455629 1993 hMEF2C gene encodes skeletal muscle- and brain-specific transcription factors.