Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.75
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma -2.200 2.9e-03
oligodendroglioma -2.100 8.9e-03
osteosarcoma -1.367 3.6e-02
chronic lymphosyte leukemia -1.600 7.0e-10
group 4 medulloblastoma -2.100 1.5e-07
atypical teratoid / rhabdoid tumor 1.300 1.1e-03
medulloblastoma, large-cell -2.200 2.3e-05
Duchenne muscular dystrophy 1.339 2.1e-07
limb girdle muscular dystrophy 2A 1.249 2.1e-04
Becker muscular dystrophy 1.119 8.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.512 2.4e-04
fascioscapulohumeral muscular dystrophy 1.146 2.8e-05
juvenile dermatomyositis 1.462 2.4e-10
primary pancreatic ductal adenocarcinoma 3.078 6.1e-04
non-small cell lung cancer -1.806 1.5e-15
sarcoidosis -1.200 3.9e-02
lung adenocarcinoma -1.200 1.5e-10
psoriasis -1.100 3.2e-06
lung carcinoma -2.500 2.3e-23
Breast cancer -1.100 1.2e-10
gastric carcinoma 1.600 7.8e-03
ductal carcinoma in situ -1.100 2.4e-02
invasive ductal carcinoma -1.100 4.1e-03
ovarian cancer 2.400 3.4e-05
pancreatic cancer 2.800 2.2e-03

Gene RIF (3)

PMID Text
23264465 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
21325632 Myeloid-associated differentiation marker (MYADM) regulates Rac1 targeting to ordered membranes required for cell spreading and migration.
12075932 Cloning and characterization of human MYADM gene whose expression was up-regulated in NB4 cells induced by all-trans retinoic acid.

AA Sequence

MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMF      1 - 70
TWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAA     71 - 140
TFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVY    141 - 210
AICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCS    211 - 280
RSHAYYVCAWDRRLAVAILTAINLLAYVADLVHSAHLVFVKV                                281 - 322
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264465 2013 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21325632 2011 MYADM regulates Rac1 targeting to ordered membranes required for cell spreading and migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17097684 2007 Membrane protein hMYADM preferentially expressed in myeloid cells is up-regulated during differentiation of stem cells and myeloid leukemia cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15900300 2005 Analysis of differential gene expression in human melanocytic tumour lesions by custom made oligonucleotide arrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12075932 2001 Cloning of human myeloid-associated differentiation marker (MYADM) gene whose expression was up-regulated in NB4 cells induced by all-trans retinoic acid.
10733104 2000 Isolation of MYADM, a novel hematopoietic-associated marker gene expressed in multipotent progenitor cells and up-regulated during myeloid differentiation.