Property Summary

NCBI Gene PubMed Count 7
PubMed Score 87.07
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 2.9
Disease Target Count Z-score Confidence
Enophthalmos 75 4.244 2.1
Methemoglobinemia 17 3.377 1.7

Expression

Gene RIF (1)

AA Sequence

MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFE      1 - 70
KPKAGPTKSVFG                                                               71 - 82
//

Text Mined References (9)

PMID Year Title