Property Summary

NCBI Gene PubMed Count 56
PubMed Score 106.60
PubTator Score 67.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.7e-09
osteosarcoma 7933 4.7e-07
Disease Target Count Z-score Confidence
Bloom syndrome 30 5.233 2.6
Aplastic anemia 19 4.362 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.905 4.7e-07
ovarian cancer -1.400 1.7e-09

Gene RIF (52)

PMID Text
26804904 Avoiding damage formation through invalidation of Mus81-Eme2 and Mre11, or preventing damage signaling by turning off the ATM pathway, suppresses the replication phenotypes of Chk1-deficient cells.
26714930 Mus81 knockdown improves the chemosensitivity of HCC cells by inducing S-phase arrest and promoting apoptosis through CHK1 pathway, suggesting Mus81 as a novel therapeutic target for HCC.
26401039 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25879486 Mus81 regulates the rate of DNA replication during normal growth by promoting replication fork progression while reducing the frequency of replication initiation events.
25618414 Authors confirmed that HIV-1 Vpr induces degradation of Mus81 although, surprisingly, degradation is independent and genetically separable from Vprs ability to induce G2 arrest.
25618414 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25496524 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25320300 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
25224045 Identification and characterization of MUS81 point mutations that abolish interaction with the SLX4 scaffold protein.MUS81 function in DNA interstrand crosslinks repair requires interaction with SLX4.
24858046 The data highlight the importance of Mus81 and Blm in DNA double-strand repair pathways, fertility, development and cancer.
24813886 Results define distinct and temporal roles for MUS81-EME1 and MUS81-EME2 in the maintenance of genome stability.
24795708 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
24744753 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
24733841 While Mus81-Eme1 shares several common features with members of the 5' flap nuclease family, the combined structural, biochemical, and biophysical analyses explain why Mus81-Eme1 preferentially cleaves 3' flap DNA substrates with 5' nicked ends.
24692662 The presence of a 5' phosphate terminus at nicks and gaps rendered DNA significantly less susceptible to the cleavage by MUS81-EME2 than its absence.
24528857 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
24412650 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that MUS81-Vpr interaction affects TNF production from HIV-1 infected cells
24204313 Our findings reveal a novel RAD52/MUS81-dependent mechanism that promotes cell viability and genome integrity in checkpoint-deficient cells, and disclose the involvement of MUS81 to multiple processes after replication stress
24080495 In vivo HJ resolution depends on both SLX4-associated MUS81-EME1 and SLX1, suggesting that they are acting in concert in the context of SLX4.
24076221 Data show that three structure-selective endonucleases, SLX1-SLX4, MUS81-EME1, and GEN1, define two pathways of Holliday junctions (HJs) resolution in HeLa cells.
23982516 This study identified a winged helix domain within the N-terminal region of human MUS81 that binds DNA, increases the activity of MUS81-EME1/EME2 complexes and influences the incision position of MUS81-EME2 but not MUS81-EME1 complexes on synthetic forks, 3' flaps and nicked Holliday junctions.
23811685 the DNA structure-specific nuclease MUS81-EME1 localizes to CFS loci in early mitotic cells, and promotes the cytological appearance of characteristic gaps or breaks observed at CFSs in metaphase chromosomes.
23361013 FBH1 helicase activity is required to eliminate cells with excessive replication stress through the generation of MUS81-induced DNA double-strand breaks.
22410776 we demonstrate that double-strand breaks, observed upon oncogene over-expression, depend on the MUS81 endonuclease, which represents a parallel pathway collaborating with WRN to prevent cell death.
22123861 Mus81 cleaves stalled replication forks, which allows dissipation of the excessive supercoiling resulting from Top1 inhibition, spontaneous reversal of Top1cc, and replication fork progression.
21859861 Results demonstrate a novel role of Wee1 in controlling Mus81-Eme1 and DNA replication in human cells.
21858151 Data show that Mus81/Eme1-dependent DNA damage--rather than a global increase in replication-fork stalling--is the cause of incomplete replication in Chk1-deficient cells.
21187482 Mus81 down-regulation correlated significantly to invasion depth (p = 0.015) and poorly-differentiated type (p = 0.016) of gastric cancer.
21175991 Mus81 is a novel prognostic marker for colorectal carcinoma
20800603 Observational study of gene-disease association. (HuGE Navigator)
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19363487 MUS81 is involved in the maintenance of ALT (alternative lengthening of telomeres) cell survival at least in part by homologous recombination of telomeres.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19017809 results demonstrate a link between branch migration activity of hRad54 and structure-specific endonuclease activity of hMus81-Eme1, suggesting that the Rad54 and Mus81-Eme1 proteins may cooperate in the processing of Holliday junction-like intermediates
18854154 Knockdown of MUS81 endonuclease homolog (S. cerevisiae, MUS81) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18852298 WRN is required to avoid accumulation of double-strand breaks and fork collapse after replication perturbation, and that prompt MUS81-dependent generation of DSBs is instrumental for recovery from hydroxyurea-mediated replication arrest.
18841572 Mutations and abnormal expression of MUS81 gene in the LSCC tissues were observed.
18841572 Observational study of gene-disease association. (HuGE Navigator)
18413719 the crystal structure of the Mus81-Eme1 complex
18310322 Mus81-Eme1 can ensure coordinate, bilateral cleavage of Holliday junction-like structures.
18054789 BLM helicase and Mus81 are required to induce transient double-stranded DNA breaks in response to DNA replication stress.
17934473 Data suggest that Mus81 suppresses chromosomal instability by converting potentially detrimental replication-associated DNA structures into intermediates that are more amenable to DNA repair.
17903171 Mus81 and FANCB have different roles in repair of DNA damage during replication in human cells
17555773 Pulsed-field gel electrophoresis of the mus81Delta mutant revealed an expansion of the rDNA locus depending on RAD52, in addition to fragmentation of Chr XII in the sgs1Deltamus81(ts) mutant at permissive temperature.
16456034 Mus81 deficiency affects cell cycle progression and promotes DNA rereplication.
15805243 Data suggest a new function of BLM in cooperating with Mus81 during processing and restoration of stalled replication forks.
14638871 Mus81 is required to repair problems that arise most frequently in the highly repetitive nucleolar DNA.
14617801 Mus81 binds to a homolog of fission yeast Eme1 in vitro and in vivo and Mus81-Eme1 resolves Holliday junctions in vivo.
12686547 hMUS81.hMMS4 complex is a structure-specific nuclease that is capable of resolving fork structure [hMMS4]
12374758 Mus81-associated endonuclease may play a more direct role in replication fork collapse by catalysing the cleavage of stalled fork structures.

AA Sequence

MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSGKEAKILQHFG      1 - 70
DGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPAQPKAGGSGSYWPARHSGARV     71 - 140
ILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSARPWPALRSLLHRNLVLRTHQPARYSLTPEGL    141 - 210
ELAQKLAESEGLSLLNVGIGPKEPPGEETAVPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRG    211 - 280
GGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFR    281 - 350
EQKFRLKRCGLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQ    351 - 420
RLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKA    421 - 490
AALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGPLT             491 - 551
//

Text Mined References (62)

PMID Year Title
26804904 2016 Signaling from Mus81-Eme2-Dependent DNA Damage Elicited by Chk1 Deficiency Modulates Replication Fork Speed and Origin Usage.
26714930 2016 Mus81 knockdown improves chemosensitivity of hepatocellular carcinoma cells by inducing S-phase arrest and promoting apoptosis through CHK1 pathway.
25879486 2015 The DNA repair endonuclease Mus81 facilitates fast DNA replication in the absence of exogenous damage.
25618414 2015 Determinants for degradation of SAMHD1, Mus81 and induction of G2 arrest in HIV-1 Vpr and SIVagm Vpr.
25224045 2014 Identification and characterization of MUS81 point mutations that abolish interaction with the SLX4 scaffold protein.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24858046 2015 Cooperation of Blm and Mus81 in development, fertility, genomic integrity and cancer suppression.
24813886 2014 MUS81-EME2 promotes replication fork restart.
24733841 2014 Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
24692662 2014 Human MUS81-EME2 can cleave a variety of DNA structures including intact Holliday junction and nicked duplex.
24204313 2013 Survival of the replication checkpoint deficient cells requires MUS81-RAD52 function.
24080495 2013 Human GEN1 and the SLX4-associated nucleases MUS81 and SLX1 are essential for the resolution of replication-induced Holliday junctions.
24076221 2013 Coordinated actions of SLX1-SLX4 and MUS81-EME1 for Holliday junction resolution in human cells.
23982516 2013 A winged helix domain in human MUS81 binds DNA and modulates the endonuclease activity of MUS81 complexes.
23811685 2013 MUS81 promotes common fragile site expression.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23361013 2013 FBH1 co-operates with MUS81 in inducing DNA double-strand breaks and cell death following replication stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22551069 2012 Human MUS81 complexes stimulate flap endonuclease 1.
22410776 2013 The WRN and MUS81 proteins limit cell death and genome instability following oncogene activation.
22123861 2011 Mus81-mediated DNA cleavage resolves replication forks stalled by topoisomerase I-DNA complexes.
21859861 2011 Wee1 controls genomic stability during replication by regulating the Mus81-Eme1 endonuclease.
21858151 2011 Structure-specific DNA endonuclease Mus81/Eme1 generates DNA damage caused by Chk1 inactivation.
21187482 2010 Down-regulation of Mus81 as a potential marker for the malignancy of gastric cancer.
21175991 2011 Downregulation of Mus81 as a novel prognostic biomarker for patients with colorectal carcinoma.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19596236 2009 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
19595721 2009 Coordination of structure-specific nucleases by human SLX4/BTBD12 is required for DNA repair.
19363487 2009 Telomere recombination requires the MUS81 endonuclease.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19017809 2008 Human Rad54 protein stimulates human Mus81-Eme1 endonuclease.
18852298 2008 Replication fork stalling in WRN-deficient cells is overcome by prompt activation of a MUS81-dependent pathway.
18841572 2008 [The mutation and expression of MUS81 gene in laryngeal squamous cell carcinoma].
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18469862 2008 Snm1B/Apollo mediates replication fork collapse and S Phase checkpoint activation in response to DNA interstrand cross-links.
18413719 2008 Crystal structure of the Mus81-Eme1 complex.
18310322 2008 Cleavage mechanism of human Mus81-Eme1 acting on Holliday-junction structures.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18054789 2008 Bloom's syndrome helicase and Mus81 are required to induce transient double-strand DNA breaks in response to DNA replication stress.
17934473 2007 The structure-specific endonuclease Mus81 contributes to replication restart by generating double-strand DNA breaks.
17903171 2007 Human Mus81 and FANCB independently contribute to repair of DNA damage during replication.
17555773 2007 Mus81 functions in the quality control of replication forks at the rDNA and is involved in the maintenance of rDNA repeat number in Saccharomyces cerevisiae.
17289582 2007 Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM.
16456034 2006 Haploinsufficiency of the Mus81-Eme1 endonuclease activates the intra-S-phase and G2/M checkpoints and promotes rereplication in human cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15805243 2005 BLM helicase facilitates Mus81 endonuclease activity in human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638871 2003 Mus81 endonuclease localizes to nucleoli and to regions of DNA damage in human S-phase cells.
14617801 2004 RNA interference inhibition of Mus81 reduces mitotic recombination in human cells.
12721304 2003 Identification and characterization of the human mus81-eme1 endonuclease.
12686547 2003 Identification and characterization of human MUS81-MMS4 structure-specific endonuclease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374758 2002 Holliday junction resolution in human cells: two junction endonucleases with distinct substrate specificities.
11741546 2001 Human Mus81-associated endonuclease cleaves Holliday junctions in vitro.
11073977 2000 Damage tolerance protein Mus81 associates with the FHA1 domain of checkpoint kinase Cds1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.