Property Summary

NCBI Gene PubMed Count 41
PubMed Score 92.09
PubTator Score 900.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6685 1.1e-36
Breast cancer 3098 3.3e-19
Atopic dermatitis 944 1.2e-03
chronic rhinosinusitis 512 1.7e-02
lung cancer 4473 2.3e-02
non primary Sjogren syndrome sicca 840 3.6e-02
Disease Target Count Z-score Confidence
Asthma 349 0.0 4.0
Disease Target Count Z-score Confidence
Ethmoid sinusitis 1 3.79 1.9
Dental caries 67 3.731 1.9
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -3.000 1.1e-36
Atopic dermatitis 2.100 1.2e-03
lung cancer -4.000 2.3e-02
non primary Sjogren syndrome sicca 1.700 3.6e-02
Breast cancer -1.600 3.3e-19
chronic rhinosinusitis 3.263 1.7e-02

Gene RIF (27)

PMID Text
25834826 The minimally invasive PTT procedure combined with Mucin 7 targeted GNPs is able to kill cancer cells and preserve healthy cells
23457413 A significant increase in sulfation was identified in salivary MUC7 from rheumatoid arthritis patients.
23002673 The present study did not disclose an association between MUC7*5/*6 and MUC7*6/*6 genotypes and gingival bleeding index.
22706105 The study did not show a correlation between the MUC7 genotypes and caries.
22167029 expression of different numbers of terminal repeats in this salivary mucin in the oral environment does not interfere with the etiopathogenesis of aggressive or chronic periodontitis
21647207 MUC7 expression in ductal adenocarcinoma (DAC) and chronic pancreatitis was not statistically significant, but MUC7 could be considered as potential marker of malignant lesions, especially in pancreatic DAC, as it was positive in 73% of these cases.
20946627 MUC5B and MUC7 from HIV patients, unlike the MUC5B and MUC7 from HIV negative individuals, did not inhibit HIV-1 activity.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19820409 A novel MUC7*5-generated variable number of tandem repeat (VNTR) polymorphism decreases the likelihood of a diagnosis of asthma in an African American population.
19820409 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
17703412 Observational study of gene-disease association. (HuGE Navigator)
16778149 Data demonstrate that TNF-alpha activates MUC7 transcription via NF-kappaB signaling pathway.
16759176 Observational study of gene-disease association. (HuGE Navigator)
16514118 When the cells were treated with a panel of cytokines, epidermal growth factor, or a bacterial product (Pseudomonas aeruginosa lipopolysaccharide [LPS]), MUC7 transcripts and glycoprotein products were increased 1.7- to 3.2-fold.
16203048 Interactions between mucin and non-mucin proteins in saliva could protect complex partners from proteolysis
15731026 reported as new substrate for StcE protease of Escherichia coli O157-H7 in HEp-2 cells
15501816 binds to Streptococcus mutans alpha-enolase [MG2]
12543672 MUC7 is a salivary mucin with antimicrobial activity against bacteria and fungi.
12459324 Level of MG2 is lower in saliva of subjects with dental disease
11996097 Structure and biosynthesis of human salivary mucins.
11378823 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRC      1 - 70
RPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTIS     71 - 140
SRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPE    141 - 210
TTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPET    211 - 280
TAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSA    281 - 350
PGQNKISRFLLYMKNLLNRIIDDMVEQ                                               351 - 377
//

Text Mined References (44)

PMID Year Title
25834826 2015 Gold nanotheranostics: photothermal therapy and imaging of Mucin 7 conjugated antibody nanoparticles for urothelial cancer.
23457413 2013 Selected reaction monitoring to differentiate and relatively quantitate isomers of sulfated and unsulfated core 1 O-glycans from salivary MUC7 protein in rheumatoid arthritis.
23002673 2011 [Association of the polymorphism of MUC7 gene encoding the low-molecular-weight mucin MG2 with susceptibility to caries].
22706105 2012 The influence of polymorphism of the MUC7 gene on the teeth and dental hygiene of students at a faculty of dentistry in Poland.
22167029 2011 Genetic polymorphism of MUC7 in individuals with aggressive or chronic periodontitis.
21647207 2011 Mucin expression pattern in pancreatic diseases: findings from EUS-guided fine-needle aspiration biopsies.
21529783 2011 A quantitative-trait genome-wide association study of alcoholism risk in the community: findings and implications.
20946627 2010 Anti-HIV-1 activity of salivary MUC5B and MUC7 mucins from HIV patients with different CD4 counts.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19820409 2009 MUC7 polymorphisms are associated with a decreased risk of a diagnosis of asthma in an African American population.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
16778149 2006 Functional analysis of human MUC7 mucin gene 5'-flanking region in lung epithelial cells.
16759176 2006 MUC7 haplotype analysis: results from a longitudinal birth cohort support protective effect of the MUC7*5 allele on respiratory function.
16514118 2006 Modulation of MUC7 mucin expression by exogenous factors in airway cells in vitro and in vivo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16203048 2005 Two-hybrid analysis of human salivary mucin MUC7 interactions.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15731026 2005 The StcE protease contributes to intimate adherence of enterohemorrhagic Escherichia coli O157:H7 to host cells.
15501816 2004 Streptococcus mutans surface alpha-enolase binds salivary mucin MG2 and human plasminogen.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766201 2003 MG2 and lactoferrin form a heterotypic complex in salivary secretions.
12543672 2003 MUC7 20-Mer: investigation of antimicrobial activity, secondary structure, and possible mechanism of antifungal action.
12507512 2003 Cloning and characterization of a novel UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, pp-GalNAc-T14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459324 Electrophoretic analysis of whole saliva and prevalence of dental caries. A study in Mexican dental students.
12417297 2002 Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T10.
12135769 2002 Molecular cloning and characterization of a novel member of the UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase family, pp-GalNAc-T12.
11996097 2000 Structure and biosynthesis of human salivary mucins.
11378823 2001 Genetic polymorphism of MUC7: allele frequencies and association with asthma.
9538010 1998 Human low-molecular-weight salivary mucin expresses the sialyl lewisx determinant and has L-selectin ligand activity.
9363439 1997 Molecular characterization of a major high molecular weight mucin from human sublingual gland.
8838308 1996 Structure and chromosomal localization of the human salivary mucin gene, MUC7.
8104046 1993 Low-molecular-mass human salivary mucin, MG2: structure and binding of Pseudomonas aeruginosa.
7690757 1993 Molecular cloning, sequence, and specificity of expression of the gene encoding the low molecular weight human salivary mucin (MUC7).
1445223 1992 Structural features of the low-molecular-mass human salivary mucin.