Property Summary

NCBI Gene PubMed Count 249
PubMed Score 932.03
PubTator Score 119.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -2.000 1.4e-07
osteosarcoma 2.223 2.7e-05
medulloblastoma, large-cell 1.300 2.1e-05
intraductal papillary-mucinous adenoma (... 6.800 9.2e-06
intraductal papillary-mucinous carcinoma... 4.200 4.3e-03
intraductal papillary-mucinous neoplasm ... 3.200 1.7e-02
lung cancer -1.200 1.7e-02
pancreatic cancer 2.700 6.0e-05
adult high grade glioma 1.100 8.1e-03
group 3 medulloblastoma -1.400 1.1e-02
nasopharyngeal carcinoma -2.200 6.8e-05
gastric carcinoma -4.500 2.2e-03
ulcerative colitis 1.300 3.0e-02
ovarian cancer 2.300 1.0e-11

Gene RIF (234)

PMID Text
26871672 Overexpression of MUC5AC has been described in idiopathic pulmonary fibrosis lungs. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201507-1322LE#.V2WAGNLrtNs
26476272 MUC5AC hypomethylation is predictive of serrated lesions with malignant potential
26420972 Review-Meta-analysis: decreased Muc5AC expression might be a poor prognostic predictor for gastric cancer.
26318254 Data show that verproside inhibits tumor necrosis factor alpha-induced mucin 5AC (MUC5AC) expression through NF-kappa B pathway.
26299896 The expression of ALPi and MUC5AC in cocultures of Caco-2 and HT29 cells developed for permeability studies is reported.
26161982 These data lend support to the notion that beta2AR-agonists may contribute to asthma exacerbations by increasing mucin production via activation of beta2ARs on epithelial cells.
26100173 is a major component of the mucus produced by airway epithelial cells.
26057128 EGF removal or tyrphostin AG1478 treatment of differentiating air-liquid interface cultures from asthmatic children would result in a reduction of epithelial goblet cells and mucus secretion.
25838093 Leukotriene E4 induces MUC5AC release from human airway epithelial NCI-H292 cells
25704757 An important role for MMP-9 activated by NADPH/reactive oxygen species signaling pathways in regulating high glucose-induced MUC5AC expression.
25649981 Studied the effects of 15-HETE on MUC5AC expression and related pathways.
25638393 Increased expression of MUC5AC was associated with bacterial biofilm formation in chronic rhinosinusitis patients.
25605164 Common genetic variations in the MUC5AC gene are not related to helicobacter pylori serologic status.
25559041 Recombinant versions of MUC5AC were produced in airway cell lines and secretion of MUC5AC was identified.
25403854 Data suggest that determination of mucin 5AC (MUC5AC) methylation status may be useful for understanding and predicting the natural history of colorectal cancers (CRC).
25376946 We found significantly increased SPDEF and MUC5AC expression in CRSwNP patients compared to the controls (P < .05); the mRNA level of SPDEF was positively correlated with MUC5AC expression in CRS patients (P < .05).
25298197 MUC5AC expression in ovarian mucinous tumors did not change from benign to malignant tumors.
25166306 Results showed that MUC5AC expression is correlated to the tumor stage where advanced gastric cancers present reduced levels of MUC5AC and that Gli regulates its expression via interaction with a highly conserved sequence in its promoter region.
25151557 serum/bile ratio showed excellent diagnostic performance for differentiating cholangiocarcinoma from cholangitis
25108707 aberrant SOX2 expression is specifically linked neither to mucinous Colorectal cancers nor to the induction of MUC5AC
25036673 the role of Akt in the regulation of MUC5AC production
24975020 these data reveal the capacity of these three S100 proteins to induce MUC5AC production in airway epithelial cells, suggesting that they all serve as key mediators linking neutrophil-dominant airway inflammation to mucin hyperproduction.
24935372 results indicated that some common genetic variations in the MUC5AC gene might have effects on the risk of non-cardia gastric cancer in our studied population.
24920497 The genetic length variants in the central repetitive region of MUC5AC were not associated with meconium ileus in cystic fibrosis.
24901817 There was no difference in the expression of deep MUC1, MUC2, MUC5AC, or MUC6 between the groups of gastric cancer and controls.
24901072 LL-37 induced TACE and EGFR activation, as well as TGF-alpha and MUC5AC mucin production by NCI-H292 cells.
24887023 results suggest that certain genetic variations in MUC5AC upstream repetitive region are associated with the susceptibility and progression of gastric cancer
24840724 Anoxia up-regulates MUC5AC by the HIF-1alpha signaling pathway in human nasal epithelia.
24810798 Our findings indicate that Notch3 signaling, associated with MUC5AC expression, could be a more favorable prognostic factor in small intestinal adenocarcinoma.
24797786 Cigarette smoke alters non-neuronal cholinergic system components inducing MUC5AC production in the H292 cell line
24722639 MUC5AC and MUC16 may have a role in poor outcome in patients with small bowel cancer
24720799 findings indicate that melatonin effectively inhibits MUC5AC expression.
24717945 production is stimulated by co-culture of airway epithelial cell line with the eosinophilic cell line or with human blood eosinophils stimul
24603585 CDX2, MUC1, MUC5AC, and MUC6 expression patterns may provide better estimations of survival after surgical resection of small intestinal adenocarcinoma.
24598137 MUC5CA gene expression was increased in middle ear epithelial cells, after urban particles exposure in a dose dependent manner.
24556756 SN induces MUC5AC hypersecretion in a dose- and time-dependent manner; moreover, the MUC5AC over synthesis induced by SN is strongly associated with the enhanced binding of EGF to NRP1
24487386 Data show that dexamethasone, a glucocorticoid that transcriptionally represses MUC5AC gene expression under constitutive conditions, also represses IL-1beta-mediated upregulation of MUC5AC gene expression.
24468034 MUC5AC could be related to tumor stage and long-term survival in patients with biliary tract cancerundergoing
24332705 Sputum is not inert and degradation reduces apparent mucin concentrations and sputum elasticity.
24120646 Results suggest that elevated shear stress induces MUC5AC hypersecretion via tyrosine-phosphorylated cortactin-associated actin polymerization in cultured human airway epithelial cells.
24102466 Respiratory morbidity associated with urban particulate matter exposure in children may be related to increased expression of MUC5AC and IL8.
24065389 PKC and NADPH oxidase regulate MUC5AC production in lipopolysaccharide-challenged human biliary epithelial cells.
24027752 Our results suggested that LPS increases MUC5AC expression through the TACE/TGF-alpha/EGFR pathway in HIBECs
24010879 Characterization of the MUC5AC gene and the sequence variation.
23953484 Acrolein increased MUC5AC gene expression on middle ear epithelial cells.
23860410 Notch signaling can directly downregulate MUC5AC promoter activity through Hes1-dependent mechanisms.
23836919 MUC5AC glycoforms may be highly specific and sensitive biomarkers for the differentiation of mucinous from nonmucinous pancreatic cysts.
23828549 High Mucin 5AC expression is associated with gastric carcinoma.
23828387 Decrease of MUC5AC expression in columnar epithelial cells and goblet exocrinocytes was found in areas of severe dysplasia and intestinal metaplasia in the precancerous tissue of stomach.
23807779 we report the expression pattern of MUC2, MUC5AC, MUC5B, and MUC6 in a large series of colorectal carcinomas
23801416 Low Muc5AC expression increased the invasion and migration of gastric cancer cells and could be a useful biomarker of poor prognosis in gastric cancer.
23768102 Rhythmic pressure waves modulate MUC5AC expression via the EGFR-PI3K-Akt/ERK-signaling pathway in human bronchial epithelial cells.
23671562 Data indicate that Il-9 and IL-13 regulate expressions of MUC5AC, SPDEF and matrix metalloproteinase 7 (MMP-7) in pediatric bronchial epithelial cell.
23619266 PGE2 induces MUC2 and MUC5AC expression in intrahepatic biliary epithelial cells via EP4-p38MAPK signaling.
23602830 Human airway trypsin-like protease can stimulate mucin5AC hypersecretion through a PAR2-mediated signaling pathway in 16HBE cells.
23582017 We found that H2 O2 induced SHP-2 activation, which acted as a suppressor in H2 O2 signalling to regulate MUC5AC transcription in the airway.
23581859 The degree of MUC5AC expression may correlate with the invasiveness and progression of Paget's disease extramammary
23551418 The MUC5AC association and the interactions with inflammatory mediators suggest that genetically determined differences in MUC5AC expression alter susceptibility to respiratory disease.
23549814 MUC5AC expression is suppressed by cell membrane cholesterol depletion in human airway epithelial cells.
23527003 The frequency of MUC5B+ and MUC5AC+ distal airways was increased in idiopathic pulmonary fibrosis. MUC5B-expressing cells were the dominant mucus cell type in the honeycomb cyst epithelium.
23464473 Down-regulated expression of MUC-2, -4 and -5AC may be involved in pathogenesis.
23392769 Neutrophil elastase can increase PAR2 expression and MUC5AC release.
23392388 IL-31 and IL-31RA are upregulated in patients with allergic rhinitis, and induce MUC5AC gene expression in human airway epithelial cells.
23292004 results indicate MUC5AC inhibits TRAILinduced apoptosis in human pancreatic cancer and may serve as an important indicator in diagnosis and prognosis
23252568 The infection of Helicobacter pylori is correlated with a decrease in MUC5AC protein amount in gastric cancer tissue.
23249391 Findings suggest that normal regulation of MUC5AC and MUC5B production by human bronchial epithelial cells is TGF-beta isoform-specific and that TGF-beta(2) downregulates both MUC5AC and MUC5B.
23113953 Thus, GGE effectively reduces cellular content and secretion of MUC5AC, increases MTR, and alters mucus rheology, and may therefore be useful in treating airway mucus hypersecretion and mucostasis in airway diseases.
23112547 MUC5 expression is significantly higher in the granular-type than in the non-granular-type of colorectal laterally spreading tumor
23084780 The hypoxia response element site site at -65 in the MUC5AC promoter and the HIF-1alpha are the major regulators for the cellular response against hypoxia in human bronchial epithelial cells.
22798432 glucocorticoid receptor and HDAC2 are recruited to the MUC5AC promoter and mediate the glucocorticoid repression of MUC5AC gene expression.
22748473 Anterior gradient homolog 2 and MUC5AC are useful positive markers of adenocarcinoma.
22700966 CS induces MUC5AC gene transcription predominantly through increased Sp1 nuclear protein levels and increased Sp1 binding to its promoter region.
22691042 Immunohistochemistry showed a reverse correlation between MUC2 and Notch3 or Jagged1 (P = 0.033 and P = 0.005, respectively) and between MUC5AC and Jagged1 or Hes1
22676183 genes associated with MUC5AC expression in smokers
22610099 PDE4B mediates ERK-dependent up-regulation of mucin MUC5AC by S. pneumoniae by inhibiting cAMP-PKA-dependent MKP-1 pathway.
22500101 By RT-PCR and ELISA, results showed that T3 inhibited MUC5AC mRNA expression and protein secretion in HBE16 cells, and further analysis demonstrated that T3 repressed MUC5AC expression, in part due to inhibition of Sp1 binding to the promoter.
22441738 It was shown that 12R-lipoxygenase is involved in MUC5AC expression via ERK- and Sp1-signalling pathways.
22391959 Macrophages are related to goblet cell hyperplasia and induce MUC5B but not MUC5AC in human bronchus epithelial cells
22389405 S. dysenteriae-induced expression of interleukin-1beta upregulates MUC2 expression and the differential expression of MUC5AC.
22388989 Apigenin and wogonin inhibit MUC5AC mucin production and gene expression in NCI-H292 epithelial cells.
22348416 MUC5AC was noted in only five cases (26%) by immunohistochemistry and was found in the mucinogenic proliferations of type 1 congenital pulmonary airway malformations.
22303480 TLR-dependent TRAF6-MKK3-p38 MAPK signaling pathway synergizes with PKCtheta;-MEK-ERK signaling pathway. CARMA1 plays a crucial role in mediating this synergistic effect via TRAF6.
22297031 The detection of the MUC5AC transcript in corneal epithelium is a more sensitive method to diagnose limbal stem cell deficiency (LSCD).
22275269 Silibinin can regulate gene expression, production and secretion of mucin by directly acting on airway epithelial cells.
22269464 Similar MUC1, MUC2 and MUC5B expression patterns were observed between mucocele-like lesions and mucinous carcinoma (MC) type A and between MC type B and mucinous carcinoma.
22261707 Report Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology and roles in neoplastic progression.
22239058 Histamine-induced increased expression of MUC5AC by activated p38MAPK/COX-2 may be a possible pathogenesis of mucus hypersecretion in allergic rhinitis.
22220206 The measurement of the CA 19-9 antigen on individual proteins could improve performance over the standard CA 19-9 assay.
22213337 The MUC5AC gene expression and secretion induced by EGF or PMA or TNF-alpha from NCI-H292 cells was inhibited by pretreatment with 100 microm of resveratrol.
22078291 Alpha-methylacyl-coenzyme A racemase expression is associated with mucin phenotypes of gastric neoplasia, particularly with the expression of CDX2 and MUC5AC.
21998660 a novel link between the MUC5AC 6.4 kb VNTR allele and severity of CF lung disease
21857919 Data indicate that SNP rs2735733 in the region of the mucin 5, subtypes A/C gene (MUC5AC) exhibited nominal evidence for association with COME/ROM.
21815153 Low MUC5AC is associated with gallbladder adenocarcinoma.
21773870 These data highlight a negative feedback role for miR-146a in the control of MUC5AC production from airway epithelial cells stimulated by neutrophil elastase.
21697763 significance of MUC5AC expression for the development of pancreatic ductal adenocarcinoma and the possibility of using MUC5AC as a target for immunotherapy for pancreatic cancer
21685325 Mucin and MUC5AC expression is selectively induced by Aspergillus fumigatus extracts or the culture supernatant of live microorganisms in NCI-H292 tumor cells and primary cultures of human airway epithelial cells.
21622856 ERK kinase activation is necessary for the regulation of epidermal growth factor receptor (EGFR)-mediated MUC5AC expression by Notch signaling in a lung carcinoma cell line.
21556755 Chronic mechanical stress can enhance MUC5AC expression in human bronchial epithelial cells through the ERK signal transduction pathway.
21544845 Epidermal growth factor receptor-mediated signaling pathways are important in regulating cigarette smoke-induced Hypoxia inducible factor-1 activation and MUC5AC expression.
21512244 role of E-cadherin in modulating mucin production
21502330 Muc5ac: a critical component mediating the rejection of enteric nematodes.
21455588 AQP5 expression increases MUC5AC and MUC5B mucin production
21418911 SphK1 plays an important role in regulating the MUC5AC expression in airway epithelial cells under the induction of TNF-alpha.
21418859 Compared with control group, the levels of OREBP, HSP70-2 and MUC5AC in supernatant significantly increased after HBE16 cells were exposed to hypertonic media.
21362305 LPS may activate ER stress through the overexpression of MUC5AC. Dexamethasone may protect human airway epithelial cells against ER stress-related apoptosis by attenuating the overload of MUC5AC.
21348892 Most TTF-1-negative pulmonary adenocarcinomas are mucinous lesions with the predominant expression of MUC5AC.
21300824 Binding of CCL20 to G protein-coupled receptor CCR6 induces MUC5AC mucin production in human airway epithelial (NCI-H292) cells via metalloprotease TNF-alpha-converting enzyme (TACE)-dependent EGFR activation.
21275604 results show that SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6.
21249315 A new dimension of MUC5AC as a functional immunosuppressive agent and its important role in pancreatic cancer progression.
21211365 Elafin may down-regulate MUC5AC overexpression through the inhibition of AP-1 and NF-kappaB.
21197415 A serum ELISA was developed using NPC-1C monoclonal antibody that reacts with specific epitopes expressed by pancreatic and colorectal tumor-associated MUC5AC that do not appear on MUC5AC from normal tissues.
21146919 Studies indicate that MUC5AC, the major mucin present in respiratory secretions, is expressed mostly by the goblet cells of the surface epithelium lining the air passages.
21139981 Both phacotrabeculectomy and short-term anti-glaucoma medications can decrease the MUC5AC in the tear fluid of primary angle-closure glaucoma patients.
21131736 After being activated by JNK and ERK which are phosphorylated by cigarette smoke, AP-1 binds to its DNA binding elements on the promoter of MUC5AC gene and up-regulates MUC5AC expression at the transcriptional level.
21097527 MCP-1 has a novel function in airway epithelium, increasing the two major airway mucins MUC5AC and MUC5B, an effect mediated, at least in part, by a cascade of events initiated by interaction of its receptor CCR2B with G(q) subunits in caveolae
21092491 Mechanical stretching could increase the expression of MUC5AC in airway epithelial cells.
20972463 GLI1-upregulated MUC5AC interfered with the membrane localization of E-cadherin, leading to decreased E-cadherin-dependent cell-cell adhesion and promoting the migration and invasion of pancreatic ductal adenocarcinoma cells.
20953890 These results support the idea about the involvement of MUC 5AC and MUC 1 with some specific sugar structures in the mechanism of Helicobacter pylori infection.
20929551 MUC1, MUC2, MUC5AC, and MUC6 may have a role in malignant transformation and invasion to mucosa or the muscularis mucosae in colorectal polyps
20734208 MUC5AC is regulated by CpG methylation and histone H3-K9 modification of the MUC5AC promoter distal region, but not by miRNAs.
20731025 Results describe the expression profiles of MUC2 and MUC5AC in tumorigenesis of colorectal carcinoma and in its different pathologic types.
20713760 This study demonstrates MUC5AC gene changes in patients with OM and highlights the need for greater understanding of the molecular responses in OM; particularly that of mucin.
20709182 benzopyrene-induced MUC5AC upregulation and mucin production were inhibited by AhR siRNA or the use of an antioxidative agent
20639461 alpha-Melanocyte-stimulating hormone inhibits tumor necrosis factor alpha-stimulated MUC5AC expression in human nasal epithelial cells
20525715 Rhinovirus induced MUC5AC in bronchial epithelial cells in vitro by activating an epidermal growth factor receptor-dependent cascade culminating in specificity protein-1 transactivation of the MUC5AC promoter.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485009 Mucinous colorectal adenocarcinomas displayed 182 upregulated and 135 downregulated genes. The most upregulated genes included those involved in cellular differentiation and mucin metabolism (eg, MUC5AC +4.2).
20464982 Increased expression of hCLCA1 in allergic rhinitis was correlated with the expression of MUC5AC.
20422702 In human nasal polyp epithelial cells, leptin increased the expression of MUC5AC and MUC5B, in a dose- and time-dependent manner, at the gene and protein levels.
20368025 There was an obvious increase of ROS production in cells exposed to neutrophil elastase, with elevation of Nox1 and MUC5AC protein production.
20362698 MUC5AC expression was increased by LPS through the EGFR-p38/JNK pathway
20338103 expression is downregulated by diatary polyphenols leading to inhibition of mucus hypersecretion
20216230 Nrf2 is a novel nuclear factor involved in down-regulating MUC5AC synthesis by inhibiting ROS generation and augmenting proteinase inhibitor production.
20117097 SHP-1 plays an important role in airway mucin production through regulating oxidative stress.
19924550 Data provide evidence that some common variations in MUC1 and MUC5AC genes contribute to an elevated risk of stomach cancer.
19924550 Observational study of gene-disease association. (HuGE Navigator)
19856421 The combination of MUC5ac and WT-1 stains is useful in distinguishing pancreatic ductal from ovarian serous carcinoma in body fluid cytology.
19841867 The production of MUC5AC is downregulated on type-IV collagen through a Src-independent pathway. In contrast, MUC5AC is upregulated on Matrigel through a Src-dependent pathway in NCI-H292 cells.
19841186 This is the first demonstration of the participation of NF-kappaB and its specific binding site in cytokine-mediated airway MUC5AC expression.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19723147 COPD is associated with increased MUC5AC expression in submucosal glands, indicating that MUC5AC may be involved in the pathophysiology of the disease.
19718741 This study compared polymorphisms in MUC2, MUC5AC, and MUC5B genes in otitis media (OM) patients and controls.
19718741 Observational study of gene-disease association. (HuGE Navigator)
19718656 MUC5AC is upregulated by IL-4 through CREB in human airway epithelial cells
19671252 [6]-Gingerol suppresses IL-1 beta -induced MUC5AC gene expression in human airway epithelial cells via the ERK- and p38 MAPK-dependent pathways; therefore, [6]-gingerol may be considered a possible anti-hypersecretory agent.
19596978 IL-8-induced binding of RNA-binding proteins to the 3'-untranslated region of MUC5AC is a potential mechanism for regulating MUC5AC gene expression at the posttranscriptional level
19558858 The production of MUC5AC in human nasal epithelial cells is regulated via the expression and activation of epidermal growth factor receptor signaling pathway.
19556605 NRG1beta1 is a novel mediator of MUC5AC and MUC5B expression in HBECs, and may represent a novel therapeutic target for mucus hypersecretion in respiratory diseases.
19501047 LPS-stimulated secretion and activation of MMP-9, and the regulatory effects of this pathway on the production of MUC5AC in the human airway cells NCI-H292 were studied.
19394453 Reduction of Human neutrophil elastase -induced MUC5AC secretion by L-carbocisteine in the pulmonary epithelial cells may partly relate to the reduction of ROS
19266212 Both solitary and SMAD4 mutated JP case showed extensive co-localization of the alterations described above: decreased expression of SMAD4, CDX2 and partially also MUC2 and de novo expression of MUC5AC.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19201889 a single pathway from PGF(2alpha) receptor to CREB is responsible for inducing MUC5AC overproduction
19201815 Prostaglandin E(2) can induce MUC5AC overproduction via the EP(4) receptor and that RGS4 may have suppressive effects in controlling MUC5AC overexpression in the airway.
19168703 Short duration episodes of mechanical stress at 30 cm H(2)O, representative of those occurring during bronchoconstriction, are sufficient to increase MUC5AC protein expression in bronchial epithelial cells in vitro.
19141355 increased expression in biopsies from patients with eosinophilic esophagitis
19059885 Regulator of G-protein signaling 4 suppresses LPS-induced MUC5AC overproduction in the airway.
18978302 The novel coupling of antiviral defense machinery (i.e., TLR3) and major epithelial proliferation/repair pathway (i.e., EGFR) might play an important role in viral-induced airway remodeling and airway disease exacerbation.
18848467 Alternatively glycosylated MUC1 and MUC5AC could be of significant potential as effective tumor markers in gastric cancer diagnosis.
18834073 These mucin genes were up-regulated after exposure to low pH in vitro (p < 0.005). Pepsin inhibited this up-regulation (p <0.001).Reflux laryngitis is associated with down-regulation of mucin gene expression.
18825309 rates of positivity for E-cadherin and beta-catenin membranous expression patterns and mucin (MUC2, MUC5AC and MUC6) positivity were higher in the young group (P<0.01)than in old patients with gastric carcinoma
18782768 pneumolysin selectively induced expression of MKP1 via a TLR4-dependent MyD88-TRAF6-ERK pathway, which inhibited the PAK4-JNK signaling pathway,leading to up-regulation of MUC5AC mucin production
18782111 Changes in conjunctival epithelial MUC5AC and MUC16 mRNA expression is thought to be important in the pathogenesis of atopic ocular surface disease.
18676374 MUC5AC gene expression are mediated by a complex regulatory cascade controlling interactions between CREB and c-Ets1 that bind to a promoter element in the MUC5AC gene enhancing MUC5AC gene transcription.
18539955 Nox4, a subtype of nonphagocytic NADPH oxidase, was found to play a key role in intracellular ROS generation and exogenous H(2)O(2)-induced MUC5AC gene expression in NHNE cells
18475301 Serum MUC5AC is a highly specific tumour-associated mucin that may be useful in the diagnosis and formulation of therapeutic strategies in biliary tract cancer (BTC).
18424749 Pendrin induced expression of MUC5AC, a major product of mucus in asthma and COPD, in airway epithelial cells
18300795 Report MUC5AC expression/pathological features of adenomatous and foveolar gastric epithelial dysplasia.
18285671 MUC5AC is over-expressed in gallstone disease, despite the decrease in the expression of EGFR mRNA.
18283638 Most signet ring cell carcinomas and adenocarcinomas of the urinary bladder secreted MUC5AC apomucin.
18254322 Histamine upregulates and Dexamethasone downregulates MUC5AC mRNA and protein expression in nasal polyps.
18201532 MUC5AC gene expression is upregulated by NGF in goblet cells.
18167142 Data demonstrate for the first time that the widely used mAb 45M1, as well as 2-12M1 and 166M1, are true antibodies against MUC5AC, with epitopes located in the C-terminal cysteine-rich part of the mucin.
18166592 Mycoplasma pneumoniae exposure significantly increases MUC5AC mRNA and protein expression preferentially in airway epithelial cells isolated from asthmatic subjects
18163520 up-regulated MUC expression by synovial tissue cells and suggest a novel role of MUC3 and MUC5AC in the pathogenesis of arthritis
18073139 Subsequently, ROS generation by PA-LPS releases transforming growth factor-alpha (TGF-alpha), which in turn, leads to up-regulate MUC5AC expression.
18027866 expression of both SOX2 and MUC5AC in serrated polyps supports the hypothesis that these polyps may be predominant precursors of mucinous and signet ring cell carcinomas of the colorectum
18006877 Acrolein, a constituent of cigarette smoke and an endogenous mediator of oxidative stress, increases airway MUC5AC production.
17991319 In colorectal adenocarcinoma MUC2 and MUC5AC expression were positively correlated to E-cad expression.
17982272 The TFF1-GKN2 heterodimer and TFF2 differ characteristically by their binding to gastric mucins.
17891046 Better basal gene expression was observed by co-cultured respiratory epithelial cells compared to dispase dissociated cells.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17659847 Intestinal cystitis glandularis expresses MUC2 and MUC5AC.
17646388 Data demonstrate that CREB activation via nonclassical retinoic acid signaling may regulate the expression of mucin genes, including MUC5AC, and mediating the early biological effects of RA during normal mucous differentiation in NHTBE cells.
17621824 Thus gene is up-regulated in sinus mucosa of chronic rhinosinusitis and nasal polyposis
17565737 Result suggest that testing of M1/MUC5AC can enhance the detection of precancerous lesions and colon cancer.
17555715 bring novel insights into our understanding of synergistic regulation of MUC5AC mucin by both pathological and physiological inducers
17543073 Type A TC of gastric phenotype could be related to lobular endocervical glandular hyperplasia of gastric phenotype.
17471237 this study demonstrates the important role for methylation and/or histone modifications in regulating the 11p15 mucin genes in epithelial cancer cells.
17401217 Downregulation of MUC5AC is associated with disease progression to adenocarcinoma of the esophagus
17395013 NAD(P)H:quinone oxidoreductase 1has an important role as a mediator of neutrophil elastase-regulated oxidant stress and MUC5AC mucin gene expression.
17356062 The isolated MU5AC gene product from ocular mucin displayes intramolecular conformational heterogeneity.
17333267 Histiocytoid features of invasive lobular carcinoma is immunopositive for MUC5AC.
17330845 Results indicate that ATBF1 in the nucleus negatively regulates the MUC5AC gene in gastric cancer by binding to an AT motif-like element in the MUC5AC promoter.
17321686 MUC5AC was isolated from an adenomatous colorectal neoplasm cell line and from gallbladder. The effect of chitinase on it was studied.
17237423 pneumolysin is required for up-regulation of MUC5AC mucin via TLR4-dependent activation of ERK1 in Streptococcus pneumoniae infections; IKK alpha and IKKbeta are distinctly involved in MUC5AC induction by S. pneumoniae via an ERK1-dependent mechanism
17227128 Expressions of membrane (MUC1) and secreted (MUC5AC, MUC6) mucins are frequently modified in reactive gastropathy.
17203232 a decrease in MUC2 expression and staining of MUC5AC in non-goblet-like cells are observed in progression of preneoplastic lesions
17148666 An inflammation-dependent EGF-R cascade causes overproduction of the gel-forming mucin MUC5AC, which accumulates in cholesterol gallstone disease. The ability to interrupt this cascade is of potential interest in the prevention of cholesterol gallstones.
16787389 The cleavage of MUC5AC and the generation of the reactive new C-terminus could contribute to the adherent and viscous mucus found at chronic lung diseases, characterized by mucus hypersecretion and lowered pH of the airways.
16722930 MUC5AC is preferentially expressed in intraductal papillary mucinous adenomas than in mucinous cystdenomas.
16596179 Increased MUC5AC is associated with the pancreatobiliary phenotype of ampulla of vater carcinoma and involved in later events in carcinogenesis, such as invasion and metastasis
16552336 The expression of MUC5AC increased with the progression of lesions in pancreatic carcinoma.
16540890 MUC5AC/glyceraldehyde 3-phosphate dehydrogenase (GAPDH) mRNA ratios in the study group was significantly increased compared with those in both control groups (P < .05).
16500622 This is the first reliable investigation of the regulation of MUC5AC mucin secretion by silencing AQP5.
16475027 Overexpresssed in the progression and lymphatic metastasis of prostate cancer.
16465045 IL-13 might induce the expression of MUC5AC and hCLCA1 gene and protein in well-differentiated NHBE cells. These cells might also differentiate into goblet cells and become hyperplastic.
16409634 Decreased survival in colorectal carcinoma patients with MUC5AC antibody positivity may be due to a decrease in the MUC5AC expression in tumor tissues of surviving carcinoma patients.
16251127 Ocular surface inflammation, tear film instability, and decreased conjunctival MUC5AC mRNA expression were thought to be important in the pathogenesis of noninfectious corneal shield ulcers in atopic ocular surface disease.
16188033 MUC1, MUC5B and MUC8, but not MUC2 or MUC5AC, are up-regulated in endometrial adenocarcinomas
16148149 HNE activates TACE via ROS generation, resulting in cleavage of pro-TGF-alpha, EGFR activation, and MUC5AC mucin expression in airway epithelial cells
16142316 TFF1, TFF2, TFF3 and MUC5AC may have roles in pathogenesis of pterygium goblet cells
16142311 MUC5AC and MUC2, TFF1 and TFF3, APC and p21 in subsets of colorectal polyps and cancers suggests a distinct pathway of pathogenesis of mucinous carcinoma of the colorectum
15640347 hypothesis that Duox1 activates TACE, cleaving pro-TGF-alpha into soluble TGF-alpha, resulting in MUC5AC mucin expression is examined and supported
15563276 There were significant differences were found in the glycosylation of MUC5B/MUC5AC or gp-340 between CF and non-CF subjects with severe lung disease, implying that CF does not influence SMG secretion mucin glycosylation in end-stage lung disease.
15531749 Metalloproteinases mediate mucin 5AC expression by epidermal growth factor receptor activation
15235131 MUC5AC expression plays an important role in impacting tumor progression in invasive ductal carcinoma of the pancreas; its expression is associated with increased survival
14988081 The concentration of MUC5AC and MUC5B are decreased in the CF airways relative to normal mucus. This may be due to a relative increase in other components of sputum in the CF airway or to a primary defect in mucin secretion in CF.
14749330 identification of five major intracellular populations of the MUC5AC polypeptide (unglycosylated monomer and dimer, GalNAc-substituted dimer, fully glycosylated dimer, and higher order oligomers)
14535999 Mucin MUC5AC is the most important carrier of the LeB carbohydrate structure in normal gastric tissue and forms the major receptor for H. pylori.
14527933 IL-1beta, in a dose- and time-dependent manner, increased the secretion of MUC5AC, but not MUC5B in bronchial epithelium
12972643 expression is meadiated by tumor necrosis factor alpha-converting enzyme in cultured airway cells
12820724 There was no correlation of MUC2 or MUC5AC mucin with polyp size or the grade of dysplasia using the non-VNTR antibodies
12690113 IL1beta and TNFalpha activation of MSK1 and CREB and cAMP-response element signaling cascades occurs via ERK/p38 MAP kinases and are crucial aspects of the intracellular mechanisms that mediate MUC5AC gene expression
12652076 FUT1 catalyses the addition of alpha-1,2-fucose to MUC1 and MUC5AC apomucins
12527922 The expression of MUC5AC in pancreatic cancer cell lines may involve additional regions or other mechanisms than proximal promoter methylation.
12417511 A significant reduction of gastric differentiation as reflected by MUC5AC immunoreactivity represents a marker of worse survival probability in gastric cancer. Finally, reduced MUC5AC positivity defines a high-risk subgroup of pTNM stage I patients.
12391274 in human pulmonary epithelial cells, IL-1beta activates ERK or p38 to induce COX-2 production, which in turn induces MUC2 and MUC5AC production.
12360467 Aberrant expression of MUC5AC and MUC6 gastric mucins and sialyl Tn antigen in intraepithelial neoplasms of the pancreas.
12042033 Overexpression of MUC5AC induced by interleukin-1 beta, tumor necrosis factor-alpha, lipopolysaccharide, and neutrophil elastase is inhibited by a retinoic acid receptor alpha antagonist.
11992401 Mapping of two new epitopes on the apomucin encoded by MUC5AC gene: expression in normal GI tract and colon tumors.
11988092 Gastric MUC5AC and MUC6 are large oligomeric mucins that differ in size, glycosylation and tissue distribution
11919081 Neutrophil elastase induces MUC5AC gene expression in airway epithelium via a pathway involving reactive oxygen species
11062147 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSVGRRKLALLWALALALACTRHTGHAQDGSSESSYKHHPALSPIARGPSGVPLRGATVFPSLRTIPVVR      1 - 70
ASNPAHNGRVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRRSQESAAPTLSRVLMKV     71 - 140
DGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGL    141 - 210
CGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVA    211 - 280
LVDVGSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSP    281 - 350
CADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSG    351 - 420
GRWSCQEVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSAFTVLAELRRCGLTDSETCLKSV    421 - 490
TLSLDGAQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLA    491 - 560
PKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRNSFEDPCSLSVENEKYAQHW    561 - 630
CSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNCERSEDCLCAALSSYVHACAAKGVQLGGWRDGVCTKP    631 - 700
MTTCPKSMTYHYHVSTCQPTCRSLSEGDITCSVGFIPVDGCICPKGTFLDDTGKCVQASNCPCYHRGSMI    701 - 770
PNGESVHDSGAICTCTHGKLSCIGGQAPAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCV    771 - 840
PGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVGCNTCTCDSRMWRCTDDPCLATCAVYGDGH    841 - 910
YLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKV    911 - 980
EVIGTDESQEVPYTIRQMGIYLVVDTDIGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATR    981 - 1050
SRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACV   1051 - 1120
NDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCR   1121 - 1190
NPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCL   1191 - 1260
CTERGVECTYKAEACVCTYNGQRFHPGDVIYHTTDGTGGCISARCGANGTIERRVYPCSPTTPVPPTTFS   1261 - 1330
FSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPTASASLPPVCGEKCLWSPWMDVSRPGR   1331 - 1400
GTDSGDFDTLENLRAHGYRVCESPRSVECRAEDAPGVPLRALGQRVQCSPDVGLTCRNREQASGLCYNYQ   1401 - 1470
IRVQCCTPLPCSTSSSPAQTTPPTTSKTTETRASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTP   1471 - 1540
SPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCLQELCTWTEWIDGSYPAPGINGGDFDTFQNLRD   1541 - 1610
EGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLPPICYNYEIRIQCCETVNVCRDI   1611 - 1680
TRLPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTLVTRNCHPRCTWT   1681 - 1750
KWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLVCR   1751 - 1820
NQDQQGPFKMCLNYEVRVLCCETPRGCHMTSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVS   1821 - 1890
LSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCLQELCTWTEW   1891 - 1960
IDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQL   1961 - 2030
PPICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTATSRGGPTA   2031 - 2100
TSVTQGTHTTPVTRNCHPRCTWTTWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSH   2101 - 2170
PEVSIEHLGQVVQCSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPKGCPVTSTPVTAPSTPSGRATSP   2171 - 2240
TQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSP   2241 - 2310
VPTTSTISAPTTSITSAPTTSTTSAPTSSTTSGPGTTPSPVPTTSITSAPTTSTTSAPTTSTTSARTSST   2311 - 2380
TSATTTSRISGPETTPSPVPTTSTTSATTTSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGPGT   2381 - 2450
TPSPVPTTSTTSAPTTRTTSAPKSSTTSAATTSTTSGPETTPRPVPTTSTTSSPTTSTTSAPTTSTTSAS   2451 - 2520
TTSTTSGAGTTPSPVPTTSTTSAPTTSTTSAPISSTTSATTTSTTSGPGTTPSPVPTTSTTSAPTTSTTS   2521 - 2590
GPGTTPSAVPTTSITSAPTTSTNSAPISSTTSATTTSRISGPETTPSPVPTASTTSASTTSTTSGPGTTP   2591 - 2660
SPVPTTSTISVPTTSTTSASTTSTTSASTTSTTSGPGTTPSPVPTTSTTSAPTTSTTSAPTTSTISAPTT   2661 - 2730
STTSATTTSTTSAPTPRRTSAPTTSTISASTTSTTSATTTSTTSATTTSTISAPTTSTTLSPTTSTTSTT   2731 - 2800
ITSTTSAPISSTTSTPQTSTTSAPTTSTTSGPGTTSSPVPTTSTTSAPTTSTTSAPTTRTTSVPTSSTTS   2801 - 2870
TATTSTTSGPGTTPSPVPTTSTTSAPTTRTTSAPTTSTTSAPTTSTTSAPTSSTTSATTTSTISVPTTST   2871 - 2940
TSVPGTTPSPVPTTSTISVPTTSTTSASTTSTTSGPGTTPSPVPTTSTTSAPTTSTTSAPTTSTISAPTT   2941 - 3010
STPSAPTTSTTLAPTTSTTSAPTTSTTSTPTSSTTSSPQTSTTSASTTSITSGPGTTPSPVPTTSTTSAP   3011 - 3080
TTSTTSAATTSTISAPTTSTTSAPTTSTTSASTASKTSGLGTTPSPIPTTSTTSPPTTSTTSASTASKTS   3081 - 3150
GPGTTPSPVPTTSTIFAPRTSTTSASTTSTTPGPGTTPSPVPTTSTASVSKTSTSHVSISKTTHSQPVTR   3151 - 3220
DCHLRCTWTKWFDIDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAESHPEVSIEHLGQVVQC   3221 - 3290
SREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPKGCPVTSTPVTAPSTPSGRATSPTQSTSSWQKSRTTT   3291 - 3360
LVTTSTTSTPQTSTTSAPTTSTTSAPTTSTTSAPTTSTTSTPQTSISSAPTSSTTSAPTSSTISARTTSI   3361 - 3430
ISAPTTSTTSSPTTSTTSATTTSTTSAPTSSTTSTPQTSKTSAATSSTTSGSGTTPSPVTTTSTASVSKT   3431 - 3500
STSHVSVSKTTHSQPVTRDCHPRCTWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCR   3501 - 3570
AKSHPEVSIEHLGQVVQCSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPKGCPVTSTSVTAPSTPSGR   3571 - 3640
ATSPTQSTSSWQKSRTTTLVTSSITSTTQTSTTSAPTTSTTPASIPSTTSAPTTSTTSAPTTSTTSAPTT   3641 - 3710
STTSTPQTTTSSAPTSSTTSAPTTSTISAPTTSTISAPTTSTTSAPTASTTSAPTSTSSAPTTNTTSAPT   3711 - 3780
TSTTSAPITSTISAPTTSTTSTPQTSTISSPTTSTTSTPQTSTTSSPTTSTTSAPTTSTTSAPTTSTTST   3781 - 3850
PQTSISSAPTSSTTSAPTASTISAPTTSTTSFHTTSTTSPPTSSTSSTPQTSKTSAATSSTTSGSGTTPS   3851 - 3920
PVPTTSTASVSKTSTSHVSVSKTTHSQPVTRDCHPRCTWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKI   3921 - 3990
CRRPEEITRLQCRAESHPEVSIEHLGQVVQCSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPKGCPVT   3991 - 4060
STPVTAPSTPSGRATSPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTSAPTTSTIPASTPSTTSAPTTSTT   4061 - 4130
SAPTTSTTSAPTHRTTSGPTTSTTLAPTTSTTSAPTTSTNSAPTTSTISASTTSTISAPTTSTISSPTSS   4131 - 4200
TTSTPQTSKTSAATSSTTSGSGTTPSPVPTTSTTSASTTSTTSAPTTSTTSGPGTTPSPVPSTSTTSAAT   4201 - 4270
TSTTSAPTTRTTSAPTSSMTSGPGTTPSPVPTTSTTSAPTTSTTSGPGTTPSPVPTTSTTSAPITSTTSG   4271 - 4340
PGSTPSPVPTTSTTSAPTTSTTSASTASTTSGPGTTPSPVPTTSTTSAPTTRTTSASTASTTSGPGSTPS   4341 - 4410
PVPTTSTTSAPTTRTTPASTASTTSGPGTTPSPVPTTSTTSASTTSTISLPTTSTTSAPITSMTSGPGTT   4411 - 4480
PSPVPTTSTTSAPTTSTTSASTASTTSGPGTTPSPVPTTSTTSAPTTSTTSASTASTTSGPGTSLSPVPT   4481 - 4550
TSTTSAPTTSTTSGPGTTPSPVPTTSTTSAPTTSTTSGPGTTPSPVPTTSTTPVSKTSTSHLSVSKTTHS   4551 - 4620
QPVTSDCHPLCAWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAESHPEVNIEHLG   4621 - 4690
QVVQCSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSVTPYGTSPTNALYPSLSTSMVSASV   4691 - 4760
ASTSVASSSVASSSVAYSTQTCFCNVADRLYPAGSTIYRHRDLAGHCYYALCSQDCQVVRGVDSDCPSTT   4761 - 4830
LPPAPATSPSISTSEPVTELGCPNAVPPRKKGETWATPNCSEATCEGNNVISLRPRTCPRVEKPTCANGY   4831 - 4900
PAVKVADQDGCCHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAE   4901 - 4970
DGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVM   4971 - 5040
FSGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPT   5041 - 5110
TVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRCHMTD   5111 - 5180
LDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPI   5181 - 5250
TEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMDCQECTCEAATWTLTCRPKLCPLPPA   5251 - 5320
CPLPGFVPVPAAPQAGQCCPQYSCACNTSRCPAPVGCPEGARAIPTYQEGACCPVQNCSWTVCSINGTLY   5321 - 5390
QPGAVVSSSLCETCRCELPGGPPSDAFVVSCETQICNTHCPVGFEYQEQSGQCCGTCVQVACVTNTSKSP   5391 - 5460
AHLFYPGETWSDAGNHCVTHQCEKHQDGLVVVTTKKACPPLSCSLDEARMSKDGCCRFCPPPPPPYQNQS   5461 - 5530
TCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGS   5531 - 5600
SRAFSYTEVEECGCMGRRCPAPGDTQHSEEAEPEPSQEAESGSWERGVPVSPMH                   5601 - 5654
//

Text Mined References (254)

PMID Year Title
26871672 2016 Mucins MUC5B and MUC5AC in Distal Airways and Honeycomb Spaces: Comparison among Idiopathic Pulmonary Fibrosis/Usual Interstitial Pneumonia, Fibrotic Nonspecific Interstitial Pneumonitis, and Control Lungs.
26476272 2016 The serrated neoplasia pathway of colorectal tumors: Identification of MUC5AC hypomethylation as an early marker of polyps with malignant potential.
26420972 2015 Prognostic value of Muc5AC in gastric cancer: A meta-analysis.
26318254 2016 Verproside inhibits TNF-?-induced MUC5AC expression through suppression of the TNF-?/NF-?B pathway in human airway epithelial cells.
26299896 2015 Optimization of Caco-2 and HT29 co-culture in vitro cell models for permeability studies.
26161982 2015 Epinephrine Activation of the ?2-Adrenoceptor Is Required for IL-13-Induced Mucin Production in Human Bronchial Epithelial Cells.
26100173 2015 Cigarette smoke augments MUC5AC production via the TLR3-EGFR pathway in airway epithelial cells.
26057128 2015 Epidermal Growth Factor Removal or Tyrphostin AG1478 Treatment Reduces Goblet Cells & Mucus Secretion of Epithelial Cells from Asthmatic Children Using the Air-Liquid Interface Model.
25838093 2015 Leukotriene E4 induces MUC5AC release from human airway epithelial NCI-H292 cells.
25704757 2015 Regulation of high glucose-mediated mucin expression by matrix metalloproteinase-9 in human airway epithelial cells.
25649981 2015 15-Hydroxyeicosatetraenoic Acid Inhibits Phorbol-12-Myristate-13-Acetate-Induced MUC5AC Expression in NCI-H292 Respiratory Epithelial Cells.
25638393 2015 Increased expression of MUC5AC and MUC5B promoting bacterial biofilm formation in chronic rhinosinusitis patients.
25605164 2014 Common genetic variations in the MUC5AC gene are not related to helicobacter pylori serologic status.
25591774 2015 Ezrin/Exocyst complex regulates mucin 5AC secretion induced by neutrophil elastase in human airway epithelial cells.
25559041 2015 Expression and characterization of a novel recombinant version of the secreted human mucin MUC5AC in airway cell lines.
25403854 2015 MUC5AC hypomethylation is a predictor of microsatellite instability independently of clinical factors associated with colorectal cancer.
25376946 2015 Enhanced expression of SAM-pointed domain-containing Ets-like factor in chronic rhinosinusitis with nasal polyps.
25298197 2015 Expression profile of mucins (MUC1, MUC2, MUC5AC, and MUC6) in ovarian mucinous tumours: changes in expression from benign to malignant tumours.
25166306 2014 Gli regulates MUC5AC transcription in human gastrointestinal cells.
25151557 2014 Assessment of bile and serum mucin5AC in cholangiocarcinoma: diagnostic performance and biologic significance.
25108707 2014 Aberrant SOX2 expression in colorectal cancers does not correlate with mucinous differentiation and gastric mucin MUC5AC expression.
25036673 2014 Akt induces down regulation of MUC5AC production in NCI-H292 human airway epithelial cells cultured on extracellular matrix.
24975020 2015 S100A8, S100A9 and S100A12 activate airway epithelial cells to produce MUC5AC via extracellular signal-regulated kinase and nuclear factor-?B pathways.
24935372 2014 Association analysis of common genetic variations in MUC5AC gene with the risk of non-cardia gastric cancer in a Chinese population.
24920497 2014 Meconium ileus in cystic fibrosis is not linked to central repetitive region length variation in MUC1, MUC2, and MUC5AC.
24901817 2014 Gastric mucin expression in first-degree relatives of gastric cancer patients.
24901072 2014 The human Cathelicidin LL-37 induces MUC5AC mucin production by airway epithelial cells via TACE-TGF-?-EGFR pathway.
24887023 2014 MUC5AC upstream complex repetitive region length polymorphisms are associated with susceptibility and clinical stage of gastric cancer.
24840724 2014 Hypoxia-mediated mechanism of MUC5AC production in human nasal epithelia and its implication in rhinosinusitis.
24810798 2014 Notch3 signaling is associated with MUC5AC expression and favorable prognosis in patients with small intestinal adenocarcinomas.
24797786 2014 Cigarette smoke alters non-neuronal cholinergic system components inducing MUC5AC production in the H292 cell line.
24722639 2014 Pathobiological implications of mucin (MUC) expression in the outcome of small bowel cancer.
24720799 2014 Melatonin inhibits MUC5AC production via suppression of MAPK signaling in human airway epithelial cells.
24717945 Eosinophil-epithelial cell interactions stimulate the production of MUC5AC mucin and profibrotic cytokines involved in airway tissue remodeling.
24603585 2014 Prognostic significance of CDX2 and mucin expression in small intestinal adenocarcinoma.
24598137 2014 Effect of urban particles on human middle ear epithelial cells.
24556756 2014 Secretoneurin induces airway mucus hypersecretion by enhancing the binding of EGF to NRP1.
24487386 2014 IL-1? induction of MUC5AC gene expression is mediated by CREB and NF-?B and repressed by dexamethasone.
24468034 2014 A novel serum marker for biliary tract cancer: diagnostic and prognostic values of quantitative evaluation of serum mucin 5AC (MUC5AC).
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
24332705 2014 Reassessment of the importance of mucins in determining sputum properties in cystic fibrosis.
24120646 2013 Cortactin mediates elevated shear stress-induced mucin hypersecretion via actin polymerization in human airway epithelial cells.
24102466 2013 Urban particulate matter induces pro-remodeling factors by airway epithelial cells from healthy and asthmatic children.
24065389 2014 LPS stimulates MUC5AC expression in human biliary epithelial cells: whether there exists a possible pathway of PKC/NADPH/ROS?
24027752 2013 LPS increases MUC5AC by TACE/TGF-?/EGFR pathway in human intrahepatic biliary epithelial cell.
24010879 2014 Genome reference and sequence variation in the large repetitive central exon of human MUC5AC.
23953484 2013 Effect of acrolein, a hazardous air pollutant in smoke, on human middle ear epithelial cells.
23860410 2013 Notch signaling downregulates MUC5AC expression in airway epithelial cells through Hes1-dependent mechanisms.
23836919 2013 Specific glycoforms of MUC5AC and endorepellin accurately distinguish mucinous from nonmucinous pancreatic cysts.
23828549 2014 Mucin phenotype expression of gastric neuroendocrine neoplasms: analysis of histopathology and carcinogenesis.
23828387 2013 Immunohistochemical evaluation of mucin expression in precancerous tissue of stomach.
23807779 2013 Expression of MUC2, MUC5AC, MUC5B, and MUC6 mucins in colorectal cancers and their association with the CpG island methylator phenotype.
23801416 2014 Decreased Muc5AC expression is associated with poor prognosis in gastric cancer.
23768102 2013 Rhythmic pressure waves induce mucin5AC expression via an EGFR-mediated signaling pathway in human airway epithelial cells.
23671562 2013 Chronic IL9 and IL-13 exposure leads to an altered differentiation of ciliated cells in a well-differentiated paediatric bronchial epithelial cell model.
23619266 PGE(2) induces MUC2 and MUC5AC expression in human intrahepatic biliary epithelial cells via EP4/p38MAPK activation.
23602830 2013 Human airway trypsin-like protease induces mucin5AC hypersecretion via a protease-activated receptor 2-mediated pathway in human airway epithelial cells.
23582017 2013 Src homology 2-containing protein tyrosine phosphatase-2 acts as a negative regulator for MUC5AC transcription via the inhibition of the ERK1/2 MAPK signalling pathway in the airway.
23581859 2014 MUC5AC expression correlates with invasiveness and progression of extramammary Paget's disease.
23551418 2013 MUC5AC and inflammatory mediators associated with respiratory outcomes in the British 1946 birth cohort.
23549814 2013 Cholesterol depletion in cell membranes of human airway epithelial cells suppresses MUC5AC gene expression.
23527003 2013 The idiopathic pulmonary fibrosis honeycomb cyst contains a mucocilary pseudostratified epithelium.
23464473 2012 Clinicopathological and prognostic significance of MUC-2, MUC-4 and MUC-5AC expression in japanese gastric carcinomas.
23392769 2013 Neutrophil elastase induces MUC5AC secretion via protease-activated receptor 2.
23392388 2013 Effects of interleukin-31 on MUC5AC gene expression in nasal allergic inflammation.
23292004 2013 MUC5AC protects pancreatic cancer cells from TRAIL-induced death pathways.
23252568 2013 Effects of Helicobacter pylori infection on MUC5AC protein expression in gastric cancer.
23249391 2013 TGF-?? decreases baseline and IL-13-stimulated mucin production by primary human bronchial epithelial cells.
23113953 2012 Effects of guaifenesin, N-acetylcysteine, and ambroxol on MUC5AC and mucociliary transport in primary differentiated human tracheal-bronchial cells.
23112547 2012 MUC5AC/?-catenin expression and KRAS gene alteration in laterally spreading colorectal tumors.
23084780 2012 Hypoxia induces mucin expression and secretion in human bronchial epithelial cells.
22798432 2012 Glucocorticoid receptor and histone deacetylase-2 mediate dexamethasone-induced repression of MUC5AC gene expression.
22748473 2012 Immunohistochemical panel for distinguishing esophageal adenocarcinoma from squamous cell carcinoma: a combination of p63, cytokeratin 5/6, MUC5AC, and anterior gradient homolog 2 allows optimal subtyping.
22700966 2012 Cigarette smoke induces MUC5AC protein expression through the activation of Sp1.
22691042 2012 Notch3 and Jagged2 contribute to gastric cancer development and to glandular differentiation associated with MUC2 and MUC5AC expression.
22676183 2012 Genes associated with MUC5AC expression in small airway epithelium of human smokers and non-smokers.
22610099 2012 Phosphodiesterase 4B mediates extracellular signal-regulated kinase-dependent up-regulation of mucin MUC5AC protein by Streptococcus pneumoniae by inhibiting cAMP-protein kinase A-dependent MKP-1 phosphatase pathway.
22500101 2012 Triiodothyronine represses MUC5AC expression by antagonizing Sp1 binding to its promoter in human bronchial epithelial HBE16 cells.
22441738 2012 A role for 12R-lipoxygenase in MUC5AC expression by respiratory epithelial cells.
22391959 2012 Macrophages are related to goblet cell hyperplasia and induce MUC5B but not MUC5AC in human bronchus epithelial cells.
22389405 2012 Differential expression of gastric MUC5AC in colonic epithelial cells: TFF3-wired IL1 ?/Akt crosstalk-induced mucosal immune response against Shigella dysenteriae infection.
22388989 2012 Phorbol ester or epidermal growth-factor-induced MUC5AC mucin gene expression and production from airway epithelial cells are inhibited by apigenin and wogonin.
22348416 2012 MUC5AC, cytokeratin 20 and HER2 expression and K-RAS mutations within mucinogenic growth in congenital pulmonary airway malformations.
22303480 2012 PKC? synergizes with TLR-dependent TRAF6 signaling pathway to upregulate MUC5AC mucin via CARMA1.
22297031 2012 Comparative study of limbal stem cell deficiency diagnosis methods: detection of MUC5AC mRNA and goblet cells in corneal epithelium.
22275269 2012 Silibinin regulates gene expression, production and secretion of mucin from cultured airway epithelial cells.
22269464 2012 Expression of MUC1, MUC2, MUC5AC and MUC5B in mucinous lesions of the breast.
22261707 2012 Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology: is this evidence of distinct gastric and intestinal pathways to carcinogenesis in Barrett Esophagus?
22239058 2011 [A preliminary study on the regulation mechanism of p38MAPK on MUC5AC in allergic rhinitis].
22220206 2011 Enhanced discrimination of malignant from benign pancreatic disease by measuring the CA 19-9 antigen on specific protein carriers.
22213337 2012 Resveratrol inhibits mucin gene expression, production and secretion from airway epithelial cells.
22078291 2012 Relationship between alpha-methylacyl-coenzyme A racemase expression and mucin phenotype in gastric cancer.
21998660 2011 Mucin variable number tandem repeat polymorphisms and severity of cystic fibrosis lung disease: significant association with MUC5AC.
21857919 2011 Evaluation of 15 functional candidate genes for association with chronic otitis media with effusion and/or recurrent otitis media (COME/ROM).
21815153 2012 Expressive levels of MUC1 and MUC5AC and their clinicopathologic significances in the benign and malignant lesions of gallbladder.
21773870 2011 MiR-146a negatively regulates neutrophil elastase-induced MUC5AC secretion from 16HBE human bronchial epithelial cells.
21697763 2011 Identification of HLA-A*0201- and A*2402-restricted epitopes of mucin 5AC expressed in advanced pancreatic cancer.
21685325 2011 Induction of mucin and MUC5AC expression by the protease activity of Aspergillus fumigatus in airway epithelial cells.
21622856 2011 MUC5AC expression through bidirectional communication of Notch and epidermal growth factor receptor pathways.
21556755 2012 Chronic mechanical stress induces mucin 5AC expression in human bronchial epithelial cells through ERK dependent pathways.
21544845 2012 Regulation of cigarette smoke-mediated mucin expression by hypoxia-inducible factor-1? via epidermal growth factor receptor-mediated signaling pathways.
21512244 2011 Inhibition of E-cadherin dependent cell-cell contact promotes MUC5AC mucin production through the activation of epidermal growth factor receptors.
21502330 2011 Muc5ac: a critical component mediating the rejection of enteric nematodes.
21455588 2011 Aquaporin 5 expression increases mucin production in lung adenocarcinoma.
21418911 2011 [Regulation of sphingosine kinase 1 in the TNF-?-induced expression of MUC5AC in airway epithelial cells].
21418859 2011 [Effect of osmotic response element binding protein on mucus secretion with hypertonicity in human airway epithelial cells].
21362305 2011 Dexamethasone protects airway epithelial cell line NCI-H292 against lipopolysaccharide induced endoplasmic reticulum stress and apoptosis.
21348892 2011 The predominant expression of hepatocyte nuclear factor 4? (HNF4?) in thyroid transcription factor-1 (TTF-1)-negative pulmonary adenocarcinoma.
21300824 2011 CCL20/CCR6 feedback exaggerates epidermal growth factor receptor-dependent MUC5AC mucin production in human airway epithelial (NCI-H292) cells.
21287531 2011 A novel serum carbohydrate marker on mucin 5AC: values for diagnostic and prognostic indicators for cholangiocarcinoma.
21275604 2010 Interleukin-13 induces mucin 5AC production involving STAT6/SPDEF in human airway epithelial cells.
21249315 2011 Tumor-associated MUC5AC stimulates in vivo tumorigenicity of human pancreatic cancer.
21211365 2010 [Effects of endogeny polypeptide elafin on MUC5AC overexpression in human airway epithelial cells].
21197415 2011 Development of a serum biomarker assay that differentiates tumor-associated MUC5AC (NPC-1C ANTIGEN) from normal MUC5AC.
21146919 2011 Role of mucins in the skin during benign and malignant conditions.
21139981 2010 The tear fluid mucin 5AC change of primary angle-closure glaucoma patients after short-term medications and phacotrabeculectomy.
21131736 2010 [Regulatory mechanism of activator protein-1 on the expression of MUC5AC induced by cigarette smoke extract].
21097527 2011 MCP-1/CCR2B-dependent loop upregulates MUC5AC and MUC5B in human airway epithelium.
21092491 2010 [The effects of stretch sensitive positive ion channel on the high externalization of MUC5AC in airway epithelial cells by mechanical stretching].
20972463 2011 GLI1 facilitates the migration and invasion of pancreatic cancer cells through MUC5AC-mediated attenuation of E-cadherin.
20953890 2011 Glycosylation of mucins present in gastric juice: the effect of helicobacter pylori eradication treatment.
20929551 2010 Mucins in neoplastic spectrum of colorectal polyps: can they provide predictions?
20734208 2010 Expression of MUC5AC, an early marker of pancreatobiliary cancer, is regulated by DNA methylation in the distal promoter region in cancer cells.
20731025 2010 Altered expression of MUC2 and MUC5AC in progression of colorectal carcinoma.
20713760 2010 MUC5AC expression in human middle ear epithelium of patients with otitis media.
20709182 2011 Arylhydrocarbon receptor (AhR) activation in airway epithelial cells induces MUC5AC via reactive oxygen species (ROS) production.
20639461 2011 ?-Melanocyte-stimulating hormone inhibits tumor necrosis factor ?-stimulated MUC5AC expression in human nasal epithelial cells.
20525715 2010 Rhinovirus induces MUC5AC in a human infection model and in vitro via NF-?B and EGFR pathways.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485009 2010 Gene expression profiling of colorectal mucinous adenocarcinomas.
20464982 2010 [Expression and clinical significance of calcium-activated chloride channel and mucins in nasal mucosa with allergic rhinitis].
20422702 2010 Expression of leptin receptor in nasal polyps: leptin as a mucosecretagogue.
20368025 2010 [Effects of c-src/Nox1/ROS on mucin5AC expression induced by neutrophil elastase in airway epithelial cells].
20362698 2010 Aquaporin 5 expression inhibited by LPS via p38/JNK signaling pathways in SPC-A1 cells.
20338103 Dietary polyphenols affect MUC5AC expression and ciliary movement in respiratory cells and nasal mucosa.
20216230 2010 Regulation of neutrophil elastase-induced MUC5AC expression by nuclear factor erythroid-2 related factor 2 in human airway epithelial cells.
20117097 2010 The tyrosine phosphatase, SHP-1, is involved in bronchial mucin production during oxidative stress.
19924550 2010 A comprehensive analysis of common genetic variation in MUC1, MUC5AC, MUC6 genes and risk of stomach cancer.
19856421 2010 Combination of MUC5ac and WT-1 immunohistochemistry is useful in distinguishing pancreatic ductal carcinoma from ovarian serous carcinoma in effusion cytology.
19841867 2010 MUC5AC production is downregulated in NCI-H292 lung cancer cells cultured on type-IV collagen.
19841186 2009 Regulation of airway MUC5AC expression by IL-1beta and IL-17A; the NF-kappaB paradigm.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19723147 2009 MUC5AC expression is increased in bronchial submucosal glands of stable COPD patients.
19718741 2010 Mucin gene polymorphisms in otitis media patients.
19718656 2009 Upregulation of MUC5AC gene expression by IL-4 through CREB in human airway epithelial cells.
19671252 [6]-Gingerol suppresses interleukin-1 beta-induced MUC5AC gene expression in human airway epithelial cells.
19596978 2009 IL-8 regulates mucin gene expression at the posttranscriptional level in lung epithelial cells.
19558858 2009 [Roles of epidermal growth factor receptor signaling pathway on cultured human nasal epithelial cells RPMI-2650].
19556605 2010 Regulation of neuregulin 1beta1-induced MUC5AC and MUC5B expression in human airway epithelium.
19501047 2009 LPS-stimulated MUC5AC production involves Rac1-dependent MMP-9 secretion and activation in NCI-H292 cells.
19394453 2009 L-carbocisteine reduces neutrophil elastase-induced mucin production.
19266212 2009 Juvenile polyps have gastric differentiation with MUC5AC expression and downregulation of CDX2 and SMAD4.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19201889 2009 CREB mediates prostaglandin F2alpha-induced MUC5AC overexpression.
19201815 2009 Suppression of prostaglandin E2-induced MUC5AC overproduction by RGS4 in the airway.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19168703 2009 Chronic intermittent mechanical stress increases MUC5AC protein expression.
19141355 2009 Relationships between eosinophilic inflammation, tissue remodeling, and fibrosis in eosinophilic esophagitis.
19059885 2009 Regulator of G-protein signaling 4 suppresses LPS-induced MUC5AC overproduction in the airway.
18978302 2009 Rhinovirus-induced major airway mucin production involves a novel TLR3-EGFR-dependent pathway.
18848467 2009 Potential application of alternatively glycosylated serum MUC1 and MUC5AC in gastric cancer diagnosis.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
18825309 2008 Cadherin-catenin adhesion system and mucin expression: a comparison between young and older patients with gastric carcinoma.
18782768 2008 MKP1 regulates the induction of MUC5AC mucin by Streptococcus pneumoniae pneumolysin by inhibiting the PAK4-JNK signaling pathway.
18782111 2008 Alterations of the ocular surface epithelial MUC16 and goblet cell MUC5AC in patients with atopic keratoconjunctivitis.
18676374 2008 cAMP-responding element-binding protein and c-Ets1 interact in the regulation of ATP-dependent MUC5AC gene expression.
18539955 2008 The role of Nox4 in oxidative stress-induced MUC5AC overexpression in human airway epithelial cells.
18475301 2008 MUC4 and MUC5AC are highly specific tumour-associated mucins in biliary tract cancer.
18424749 2008 Identification of pendrin as a common mediator for mucus production in bronchial asthma and chronic obstructive pulmonary disease.
18300795 2008 Adenomatous and foveolar gastric dysplasia: distinct patterns of mucin expression and background intestinal metaplasia.
18285671 2008 Increased expression of mucin 5AC mRNA and decreased expression of epidermal growth-factor receptor mRNA in gallstone patients.
18283638 2008 Tumor-associated neoexpression of the pS2 peptide and MUC5AC mucin in primary adenocarcinomas and signet ring cell carcinomas of the urinary bladder.
18254322 2007 [Effects of glucocorticoid and histamine on MUC5AC mRNA and protein expression in human nasal polyps].
18201532 2007 [The effect of nerve growth factor on proliferation and expression of mucin gene in human conjunctival goblet cells].
18167142 2008 Mapping of the 45M1 epitope to the C-terminal cysteine-rich part of the human MUC5AC mucin.
18166592 2008 Mycoplasma pneumoniae induces airway epithelial cell expression of MUC5AC in asthma.
18163520 2008 Expression of mucin 3 and mucin 5AC in arthritic synovial tissue.
18073139 2008 Reactive oxygen species regulate Pseudomonas aeruginosa lipopolysaccharide-induced MUC5AC mucin expression via PKC-NADPH oxidase-ROS-TGF-alpha signaling pathways in human airway epithelial cells.
18027866 2008 Aberrant expression of SOX2 upregulates MUC5AC gastric foveolar mucin in mucinous cancers of the colorectum and related lesions.
18006877 2008 Acrolein-activated matrix metalloproteinase 9 contributes to persistent mucin production.
17991319 2007 [Expression and clinical significance of Mucin and E-cadherin in colorectal tumors].
17982272 2007 Biosynthesis of gastrokine-2 in the human gastric mucosa: restricted spatial expression along the antral gland axis and differential interaction with TFF1, TFF2 and mucins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17891046 2007 Human nasal turbinates as a viable source of respiratory epithelial cells using co-culture system versus dispase-dissociation technique.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17659847 2007 Differences in the expression of mucins in various forms of cystitis glandularis.
17646388 2007 Regulation of mucin gene expression by CREB via a nonclassical retinoic acid signaling pathway.
17621824 The expression of MUC5AC and MUC5B mucin genes in the mucosa of chronic rhinosinusitis and nasal polyposis.
17565737 2007 Abnormal expression of M1/MUC5AC mucin in distal colon of patients with diverticulitis, ulcerative colitis and cancer.
17555715 2007 Opposing roles of PAK2 and PAK4 in synergistic induction of MUC5AC mucin by bacterium NTHi and EGF.
17543073 2007 Gastric mucin is expressed in a subset of endocervical tunnel clusters: type A tunnel clusters of gastric phenotype.
17471237 2007 Epigenetic regulation (DNA methylation, histone modifications) of the 11p15 mucin genes (MUC2, MUC5AC, MUC5B, MUC6) in epithelial cancer cells.
17401217 Mucin expression profile in Barrett's, dysplasia, adenocarcinoma sequence in the esophagus.
17395013 2007 Regulation of MUC5AC expression by NAD(P)H:quinone oxidoreductase 1.
17356062 2007 The isolated MUC5AC gene product from human ocular mucin displays intramolecular conformational heterogeneity.
17333267 2007 Expression of aberrant mucins in lobular carcinoma with histiocytoid feature of the breast.
17330845 2007 Subcellular localization of ATBF1 regulates MUC5AC transcription in gastric cancer.
17321686 2007 Mucolytic activity of bacterial and human chitinases.
17237423 2007 A novel role for IkappaB kinase (IKK) alpha and IKKbeta in ERK-dependent up-regulation of MUC5AC mucin transcription by Streptococcus pneumoniae.
17227128 2007 Mucin expression in reactive gastropathy: an immunohistochemical analysis.
17203232 2007 Intestinal MUC2 and gastric M1/MUC5AC in preneoplastic lesions induced by 1,2-dimethylhydrazine in rat: a sequential analysis.
17148666 2006 MUC5AC, a gel-forming mucin accumulating in gallstone disease, is overproduced via an epidermal growth factor receptor pathway in the human gallbladder.
16787389 2006 Cleavage in the GDPH sequence of the C-terminal cysteine-rich part of the human MUC5AC mucin.
16722930 2006 Human pancreatic mucinous cystadenoma is characterized by distinct mucin, cytokeratin and CD10 expression compared with intraductal papillary-mucinous adenoma.
16596179 2006 Expression of gastric mucin MUC5AC and gastric transcription factor SOX2 in ampulla of vater adenocarcinoma: comparison between expression patterns and histologic subtypes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16552336 2006 Histopathologic evaluation of stepwise progression of pancreatic carcinoma with immunohistochemical analysis of gastric epithelial transcription factor SOX2: comparison of expression patterns between invasive components and cancerous or nonneoplastic intraductal components.
16540890 2006 Up-regulation of MUC5AC and MUC5B mucin genes in nasopharyngeal respiratory mucosa and selective up-regulation of MUC5B in middle ear in pediatric otitis media with effusion.
16500622 2006 Regulation of MUC5AC mucin secretion by depletion of AQP5 in SPC-A1 cells.
16475027 2005 MUC1, MUC2, MUC4, MUC5AC and MUC6 expression in the progression of prostate cancer.
16465045 2006 Relationship between calcium-activated chloride channel 1 and MUC5AC in goblet cell hyperplasia induced by interleukin-13 in human bronchial epithelial cells.
16409634 2006 Humoral immune response to MUC5AC in patients with colorectal polyps and colorectal carcinoma.
16251127 2005 Ocular surface and MUC5AC alterations in atopic patients with corneal shield ulcers.
16188033 2005 Differential expression of MUC genes in endometrial and cervical tissues and tumors.
16148149 2005 Neutrophil elastase induces MUC5AC mucin production in human airway epithelial cells via a cascade involving protein kinase C, reactive oxygen species, and TNF-alpha-converting enzyme.
16142316 2005 Trefoil factor family mRNA and protein expression in pterygium.
16142311 2005 Expression of mucin core proteins, trefoil factors, APC and p21 in subsets of colorectal polyps and cancers suggests a distinct pathway of pathogenesis of mucinous carcinoma of the colorectum.
15640347 2005 Dual oxidase 1-dependent MUC5AC mucin expression in cultured human airway epithelial cells.
15563276 2005 Mucin glycosylation changes in cystic fibrosis lung disease are not manifest in submucosal gland secretions.
15531749 2005 Metalloproteinases mediate mucin 5AC expression by epidermal growth factor receptor activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15235131 2003 Expression of MUC5AC and MUC6 in invasive ductal carcinoma of the pancreas and relationship with prognosis.
14988081 2004 MUC5AC and MUC5B Mucins Are Decreased in Cystic Fibrosis Airway Secretions.
14749330 2004 Identification of molecular intermediates in the assembly pathway of the MUC5AC mucin.
14718370 2004 C-Mannosylation of MUC5AC and MUC5B Cys subdomains.
14535999 2003 The MUC5AC glycoprotein is the primary receptor for Helicobacter pylori in the human stomach.
14527933 2004 Regulation of MUC5AC mucin secretion and airway surface liquid metabolism by IL-1beta in human bronchial epithelia.
12972643 2003 Tumor necrosis factor alpha-converting enzyme mediates MUC5AC mucin expression in cultured human airway epithelial cells.
12820724 Abnormal subcellular distribution of mature MUC2 and de novo MUC5AC mucins in adenomas of the rectum: immunohistochemical detection using non-VNTR antibodies to MUC2 and MUC5AC peptide.
12690113 2003 Interleukin-1 beta and tumor necrosis factor-alpha induce MUC5AC overexpression through a mechanism involving ERK/p38 mitogen-activated protein kinases-MSK1-CREB activation in human airway epithelial cells.
12652076 2002 The expression of human FUT1 in HT-29/M3 colon cancer cells instructs the glycosylation of MUC1 and MUC5AC apomucins.
12527922 2003 Methylation status of promoters and expression of MUC2 and MUC5AC mucins in pancreatic cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417511 2002 Correlation of MUC5AC immunoreactivity with histopathological subtypes and prognosis of gastric carcinoma.
12391274 2002 Interleukin-1beta induces MUC2 and MUC5AC synthesis through cyclooxygenase-2 in NCI-H292 cells.
12360467 2002 Aberrant expression of MUC5AC and MUC6 gastric mucins and sialyl Tn antigen in intraepithelial neoplasms of the pancreas.
12042033 2002 Overexpression of mucin genes induced by interleukin-1 beta, tumor necrosis factor-alpha, lipopolysaccharide, and neutrophil elastase is inhibited by a retinoic acid receptor alpha antagonist.
11992401 2002 Mapping of two new epitopes on the apomucin encoded by MUC5AC gene: expression in normal GI tract and colon tumors.
11988092 2002 Gastric MUC5AC and MUC6 are large oligomeric mucins that differ in size, glycosylation and tissue distribution.
11535137 2001 Human mucin gene MUC5AC: organization of its 5'-region and central repetitive region.
11445551 2001 In vivo glycosylation of mucin tandem repeats.
11181995 2001 The sequence of the human genome.
11062147 2000 Polymorphism of human mucin genes in chest disease: possible significance of MUC2.
10611155 2000 pS2/TFF1 interacts directly with the VWFC cysteine-rich domains of mucins.
9620876 1998 Genomic organization of the 3'-region of the human MUC5AC mucin gene: additional evidence for a common ancestral gene for the 11p15.5 mucin gene family.
9588204 1998 Molecular cloning of human gastric mucin MUC5AC reveals conserved cysteine-rich D-domains and a putative leucine zipper motif.
9506983 1998 Cloning of the amino-terminal and 5'-flanking region of the human MUC5AC mucin gene and transcriptional up-regulation by bacterial exoproducts.
9422745 1998 Human mucin genes MUC2, MUC3, MUC4, MUC5AC, MUC5B, and MUC6 express stable and extremely large mRNAs and exhibit a variable length polymorphism. An improved method to analyze large mRNAs.
8948439 1995 Cloning and analysis of human gastric mucin cDNA reveals two types of conserved cysteine-rich domains.
7826332 1995 Characterization of the human mucin gene MUC5AC: a consensus cysteine-rich domain for 11p15 mucin genes?
7775418 1995 Characterization of a mucin cDNA clone isolated from HT-29 mucus-secreting cells. The 3' end of MUC5AC?
7657101 1995 Expression cloning of gastric mucin complementary DNA and localization of mucin gene expression.
7513696 1994 Cloning and analysis of cDNA encoding a major airway glycoprotein, human tracheobronchial mucin (MUC5).
2656675 1989 Proteolytic fragmentation and peptide mapping of human carboxyamidomethylated tracheobronchial mucin.