Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.19
PubTator Score 15.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 2.1e-05

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.200 2.1e-05

Gene RIF (10)

PMID Text
26770020 increased gene expression of MUC16 and MUC20 was found in patients with remission ulcerative colitis
26673820 High MUC20 expression is associated wit response to chemotherapy in esophageal squamous cell carcinoma.
26616226 Results suggest that MUC20 enhances aggressive behaviors of EOC cells by activating integrin beta1 signaling and provide novel insights into the role of MUC20 in ovarian cancer metastasis.
26323930 A combination of MUC13/MUC20 expression was a potential prognostic marker for patients with ESCC, who received neoadjuvant chemotherapy followed by surgery.
25168902 MUC20 is a novel transmembrane mucin expressed by the human corneal and conjunctival epithelia, and suggest that differential expression of MUC20 during differentiation has a role in maintaining ocular surface homeostasis.
23787019 MUC20 is expressed in recurrent colorectal neoplasms and may have a role in poor outcome
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
16508246 Observational study of gene-disease association. (HuGE Navigator)
16029633 Observational study of gene-disease association. (HuGE Navigator)
15314156 Results suggest that MUC20 is a novel regulator of the Met signaling cascade which has a role in suppression of the Grb2-Ras pathway.

AA Sequence

MGCLWGLALPLFFFCWEVGVSGSSAGPSTRRADTAMTTDDTEVPAMTLAPGHAALETQTLSAETSSRAST      1 - 70
PAGPIPEAETRGAKRISPARETRSFTKTSPNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPREAIF     71 - 140
DTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDSPHPVITPSRASESSASSDGPHPVITPSR    141 - 210
ASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHP    211 - 280
VITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSAS    281 - 350
SDGLHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSWSPGSDVTLLAEALVTVTNIE    351 - 420
VINCSITEIETTTSSIPGASDTDLIPTEGVKASSTSDPPALPDSTEAKPHITEVTASAETLSTAGTTESA    421 - 490
APDATVGTPLPTNSATEREVTAPGATTLSGALVTVSRNPLEETSALSVETPSYVKVSGAAPVSIEAGSAV    491 - 560
GKTTSFAGSSASSYSPSEAALKNFTPSETPTMDIATKGPFPTSRDPLPSVPPTTTNSSRGTNSTLAKITT    561 - 630
SAKTTMKPPTATPTTARTRPTTDVSAGENGGFLLLRLSVASPEDLTDPRVAERLMQQLHRELHAHAPHFQ    631 - 700
VSLLRVRRG                                                                 701 - 709
//

Text Mined References (26)

PMID Year Title
26770020 2015 Differential Expression of MUC12, MUC16, and MUC20 in Patients with Active and Remission Ulcerative Colitis.
26673820 2016 Possible prediction of the response of esophageal squamous cell carcinoma to neoadjuvant chemotherapy based on gene expression profiling.
26616226 2016 MUC20 promotes aggressive phenotypes of epithelial ovarian cancer cells via activation of the integrin ?1 pathway.
26323930 2015 The expression and prognostic significance of Mucin 13 and Mucin 20 in esophageal squamous cell carcinoma.
25168902 2014 Expression analysis of the transmembrane mucin MUC20 in human corneal and conjunctival epithelia.
23787019 2013 Role of MUC20 overexpression as a predictor of recurrence and poor outcome in colorectal cancer.
23625723 2013 Antitumor T cell responses in bladder cancer are directed against a limited set of antigens and are modulated by regulatory T cells and routine treatment approaches.
23262208 2013 MUC20 overexpression predicts poor prognosis and enhances EGF-induced malignant phenotypes via activation of the EGFR-STAT3 pathway in endometrial cancer.
22929560 2013 Molecular organization of the mucins and glycocalyx underlying mucus transport over mucosal surfaces of the airways.
22663354 2012 Mapping the protein domain structures of the respiratory mucins: a mucin proteome coverage study.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
17058067 2006 Aberrant intestinal expression and allelic variants of mucin genes associated with inflammatory bowel disease.
16997931 2006 Mucin gene expression in human male urogenital tract epithelia.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16508246 2006 Tandem repeats polymorphism of MUC20 is an independent factor for the progression of immunoglobulin A nephropathy.
16029633 2005 [Variable number of tandem repeats polymorphism of MUC20 is associated with the progression of IgA nephropathy].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15314156 2004 MUC20 suppresses the hepatocyte growth factor-induced Grb2-Ras pathway by binding to a multifunctional docking site of met.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14565953 2004 Molecular cloning, genomic structure, and expression analysis of MUC20, a novel mucin protein, up-regulated in injured kidney.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.