Property Summary

NCBI Gene PubMed Count 149
PubMed Score 723.70
PubTator Score 658.39

Knowledge Summary

Patent

No data available

 GWAS Trait (1)

Gene RIF (122)

PMID Text
25921338 Our results unraveled an important regulatory role for MUC2 mucin in human beta-defensin2 mRNA and peptide production in a proinflammatory milieu
25638393 There was no significant difference in MUC2 expression between chronic rhinosinusitis patients with and without bacterial biofilm formation.
25406038 Data indicate that seventeen of the 18 N-glycan consensus sites were identified as glycosylated intestinal MUC2mucin.
25298197 In ovarian mucinous tumors, MUC2 expression changes with the progression of benign to borderline and malignant tumours
24920497 The genetic length variants in the central repetitive region of MUC2 were not associated with meconium ileus in cystic fibrosis.
24901817 There was no difference in the expression of deep MUC1, MUC2, MUC5AC, or MUC6 between the groups of gastric cancer and controls.
24840470 The expression of a subset of mucins (MUC2, MUC6, MUC5B) was also correlated with sialyl-Tn expression in LS174T cells.
24816392 MUC2 is the major gel-forming mucin of the colon forming a protective gel barrier. The N-terminal domains play an important role in structural organizing of MUC2.
24714692 The results indicated that the DNA methylation status of MUC1, MUC2 and MUC4 in pancreatic juice matched with the mucin expression in tissue.
24566630 These data suggest that the inflammatory cytokine response acts to protect host epithelial cells against E. coli O157:H7 colonization, at least in part, by promoting mucin production.
24478067 YghJ is a highly conserved metalloprotease that influences intestinal colonization of enterotoxigenic Escherichia coli by degrading the major mucins in the small intestine, MUC2 and MUC3.
24478066 Authors demonstrate that EatA, an immunogenic secreted serine protease of enterotoxigenic Escherichia coli, contributes to virulence by degrading MUC2.
24324582 High MUC2 expression in ovarian cancer is inversely associated with the M1/M2 ratio of tumor-associated macrophages and patient survival time.
24290360 MUC2 expression is an adverse prognostic indicator in submucosal esophageal adenocarcionmas, independent of node stage and other prognostic factors.
24280573 MUC2 expression clearly identified high-grade dysplasia and invasive pancreatic carcinoma and may provide most appropriate surgical indication
23807779 we report the expression pattern of MUC2, MUC5AC, MUC5B, and MUC6 in a large series of colorectal carcinomas
23619266 PGE2 induces MUC2 and MUC5AC expression in intrahepatic biliary epithelial cells via EP4-p38MAPK signaling.
23546879 bacteria can produce proteases capable of dissolving the inner protective mucus layer by specific cleavages in the MUC2 mucin; this cleavage can be modulated by site-specific O-glycosylation by the Porphyromonas gingivalis secreted cysteine protease RgpB
23464473 Down-regulated expression of MUC-2, -4 and -5AC may be involved in pathogenesis.
23464457 Expression of Hath1, Muc2, cyclin D1 and p27 in the xenograft tumors was also detected.
23347460 The results suggested that MUC2 mRNA silenced by promoter hypermethylation is associated with high levels HBV in HCC.
23305535 Secretory carcinomas of breast show a unique pattern of strong MUC2, MUC6, and MUC 4 expression.
23179399 Loss of MUC2 expression is associated with recurrence in colorectal carcinoma.
23011828 CDX2, COX2 and MUC2 expressions were seen in the intestinal epithelium having goblet cells in Barrett's esophagus
22752373 High muc-2 mrna expression is associated with lymphatic metastasis in colon cancer.
22691042 Immunohistochemistry showed a reverse correlation between MUC2 and Notch3 or Jagged1 (P = 0.033 and P = 0.005, respectively) and between MUC5AC and Jagged1 or Hes1
22582780 Histamine-induced MUC2 mRNA expression and mucin secretion were significantly suppressed by pretreatment with H1R antagonist.
22451922 The MUC2-N aggregates were dissolved by removing Ca(2+) and raising pH.
22417007 Our data present MUC2 as a new candidate involved in development of endometriosis and related infertility
22402132 The results indicate, for the first time, that genetic variability in the MUC2 gene is associated with evolution of gastric cancer precursor lesions.
22269464 Similar MUC1, MUC2 and MUC5B expression patterns were observed between mucocele-like lesions and mucinous carcinoma (MC) type A and between MC type B and mucinous carcinoma.
22261707 Report Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology and roles in neoplastic progression.
22116730 In colon cancer, the expression of mucin1 can be promoted by rIL-6, while the expression of mucin2 can be inhibited.
22073249 in vitro mucin-binding assay revealed both Shigella dysenteriae and Shigella flexneri have binding affinity in the increasing order of: guinea pig small intestinal mucin
21831773 Lactobacillus and Bifidobacterium species do not secrete protease to cleaves the MUC2 mucin in the colon mucus.
21700631 MUC1 and MUC2 expression was useful for classification of ampullary cancer.
21647207 The expression of MUC1 and MUC2 was not significantly higher in neoplastic than nonneoplastic tissues.
21618511 Data show that low lymph node MUC2/CEA mRNA ratio identified colorectal cancer (CRC) with high risk for recurrence (p = 0.011).
21605079 Inhibition of MUC2 expression induced proliferation and invasion/migration in LS174T colorectal cancer cells.
21602660 MUC2 staining in nongoblet columnar cells is a reasonably sensitive and highly specific marker for goblet cells in the distal esophagus and gastroesophageal junction.
21596555 Polymorphisms in MUC1, MUC2, MUC5B and MUC6 genes are not associated with the risk of chronic atrophic gastritis.
21441843 Data suggest that attention should be paid to the emergence of invasive IPMN from flat foci in MUC2-positive and MUC1/2-negative cases.
21318237 Based on sequence-structure alignments and three-dimensional modeling, a cystine knot tertiary structure homologous to that of human chorionic gonadotropin is predicted at the C-terminus of MUC2.
21290483 Altered O-glycosylation profile of MUC2 mucin occurs in active ulcerative colitis and is associated with increased inflammation.
21125297 MUC2 gene expression showed a regional distinction between regions 1 and 4 of the small intestine but not between regions 1 and 3.
20929551 MUC1, MUC2, MUC5AC, and MUC6 may have a role in malignant transformation and invasion to mucosa or the muscularis mucosae in colorectal polyps
20878553 MUC2 expression is increased from well differentiated to moderately differentiated to poorly differentiated in gastric adenocarcinoma.
20873538 IL-1 beta increased MUC2/MUC5B mRNA levels in human nasal epithelial cells.
20865330 Loss of MUC2 is associated with colorectal carcinoma.
20731025 Results describe the expression profiles of MUC2 and MUC5AC in tumorigenesis of colorectal carcinoma and in its different pathologic types.
20718712 Sodium butyrate increased PTEN expression, promoted the expression of MUC2 and induced the differentiation of gastric cancer cells through the PTEN/PI3K signalling pathway.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485009 Mucinous colorectal adenocarcinomas displayed 182 upregulated and 135 downregulated genes. The most upregulated genes included those involved in cellular differentiation and mucin metabolism (eg, MUC2 + 2.8).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198339 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20198318 Concluded that low methylation status of MUC2 gene plays a predominant role in high level MUC2 expression in mucinous colorectal neoplasms.
20065027 The authors demonstrate that apically atypical enteropathogenic Escherichia coli infection is followed by increased production of secreted MUC2 and MUC5AC mucins and membrane-bound MUC3 and MUC4 mucins.
19815850 The MUC2 is a major carrier of the sialyl-Tn antigen in all IM cases and in most gastric carcinoma cases.
19718741 This study compared polymorphisms in MUC2, MUC5AC, and MUC5B genes in otitis media (OM) patients and controls.
19718741 Observational study of gene-disease association. (HuGE Navigator)
19321523 In contrast to the O-glycans of other mucins, the sigmoid MUC2 O-glycan repertoire and relative amounts in normal individuals were relatively constant
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19246635 Systemic threonine is rapidly incorporated into MUC2 in the small intestine of preterm infants, and thereby MUC2 has a very high synthesis rate.
19201396 Macrophage-derived interleukin-6 up-regulates MUC1, but down-regulates MUC2 expression in colon cancer.
19119477 CK20 and MUC2 mRNA were quantitated in 52 normal lymph nodes from 12 patients undergoing surgery for benign bowel diseases and in 144 primary colon tumors.
18834073 These mucin genes were up-regulated after exposure to low pH in vitro (p < 0.005). Pepsin inhibited this up-regulation (p <0.001). Reflux laryngitis is associated with down-regulation of mucin gene expression.
18825309 rates of positivity for E-cadherin and beta-catenin membranous expression patterns and mucin (MUC2, MUC5AC and MUC6) positivity were higher in the young group (P<0.01)than in old patients with gastric carcinoma
18566135 These results showed that Campylobacter jejuni utilizes MUC2 as an environmental cue for the modulation of expression of genes with various functions including colonization and pathogenicity.
18487999 Mucinous adenocarcinoma of the prostate shows diffuse expression of MUC2 but was not present in normal prostate or the majority of conventional prostatic adenocarcinomas.
18301248 a significant negative correlation between immunohistochemical expression of MUC2 in preoperative radiochemotherapy biopsies and regression grade in postoperative specimens (r=-0.529; P=0.002).
18300795 Report MUC2 expression/pathological features of adenomatous and foveolar gastric epithelial dysplasia.
18299935 MUC2 expression is highest in the malignant form of peritoneal mucinous carcinomatosis
18059019 LL-37 can directly stimulate mucus synthesis through activation of MUC1 and MUC2 expression and MAP kinase pathway in human colonic cells.
18038313 In addition to CDX2 and MUC2 antibodies, HepPar-1 immunoexpression seems to have a potential role in differential diagnosis of periampullary adenocarcinomas.
18004654 mucins from intestinal transposed segments are abnormally glycosylated
18000536 Observational study of gene-disease association. (HuGE Navigator)
17991319 In colorectal adenocarcinoma MUC2 and MUC5AC expression were positively correlated to E-cad expression.
17982272 The TFF1-GKN2 heterodimer and TFF2 differ characteristically by their binding to gastric mucins.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17674761 Up-regulation of MUC2 in chronic rhinosinusitis may play an important role in the pathogenesis of sinus hypersecretion.
17659847 Intestinal cystitis glandularis expresses MUC2 and MUC5AC.
17509526 structural analysis of L- and D-amino acid-substituted mucin 2 epitope peptides
17471237 In conclusion, this study demonstrates the important role for methylation and/or histone modifications in regulating the 11p15 mucin genes in epithelial cancer cells.
17401217 Upregulation of MUC2 reflects intestinal metaplasia in Barrett's esophagus
17333267 Histiocytoid features of invasive lobular carcinoma is immunopositive for MUC2.
17321686 MUC2 was isolated from an adenomatous colorectal neoplasm tumor line and the effect of chitinase on it was studied.
17203232 a decrease in MUC2 expression and staining of MUC5AC in non-goblet-like cells are observed in progression of preneoplastic lesions
17058067 Aberrant intestinal expression and allelic variant MUC2 is associated with inflammatory bowel disease.
16754877 Data show that the C-terminal domain of Muc2 is specifically targeted by Entamoeba histolytica cysteine proteases, while the N-terminal domain is resistant to proteolysis.
16733847 High expression of MUC2 was associated with mucinous subtype of the WHO classification and with group II of Goseki's classification identified by the major component of a particular tumor.
16721789 histone H3 modification in the 5' flanking region play an important role in MUC2 gene expression, possibly affecting DNA methylation
16552339 careful systemic surveillance is needed to detect coexisting gastrointestinal cancer for subtypes of intraductal papillary mucinous neoplasms with MUC2 expression.
16475027 Overexpresssed in the progression and lymphatic metastasis of prostate cancer.
16447040 MUC2-positive tumours were significantly associated with the gain of 19p13.3, compared with MUC2-negative tumours (41.2 vs 5.9%, P=0.0391).
16285957 Galectin-3 up-regulation of MUC2 transcription occurs at the level of transcription through AP-1 activation in colon cancer cells
16227528 CREB/ATF1 and c-Jun were shown to bind to an oligonucleotide encompassing a distal, conserved CREB/AP1 site in the 5'-flanking region of the MUC2 gene, and this cis element was shown to mediate promoter reporter activation by VIP
16188033 MUC1, MUC5B and MUC8, but not MUC2 or MUC5AC, are up-regulated in endometrial adenocarcinomas
16142311 MUC5AC and MUC2, TFF1 and TFF3, APC and p21 in subsets of colorectal polyps and cancers suggests a distinct pathway of pathogenesis of mucinous carcinoma of the colorectum
15733066 PI3-K promotes the expression of TFF3 and MUC2 and that the PI3-K pathway may play a pivotal role in intestinal goblet cell differentiation.
15665513 TNF-alpha causes a net up-regulation of MUC2 gene expression in cultured colon cancer cells because NF-kappaB transcriptional activation of this gene is able to counter-balance the suppressive effects of the JNK pathway
15345696 MUC2 mucin expression is increased in response to adenosine in airway epithelial cells.
15240568 CDX2 and MUC2 genes are repressed by SOX9 in intestinal epithelium
15081123 complete genomic (exon/intron) organization
15048136 Aberrant expression of CDX2 is closely related to the overexpression of MUC2 in mucinous intrahepatic cholangiocarcinoma and intraductal papillary neoplasia of the liver associated with hepatolithiasis.
14616551 expression pattern of MUC2 in salivary gland neoplasia may be of value for the classification of salivary gland tumors
14550542 mucin is transcriptionally upregulated in an NF-kappaB- and p38-dependent manner when homogeneous cultures of epithelial cells are exposed to dsRNA
14525978 Cdx-2 activates the expression of MUC2 mucin gene in gastric cells, inducing an intestinal transdifferentiation phenotype that parallels what is observed both in intestinal metaplasia and some gastric carci
12848848 findings show that MUC2 mRNA expression is differently controlled by IL-4, IL-13, or TNF-alpha in LS174T and HT29 cells; the mitogen-activated protein kinase pathway plays a role in the MUC2 mRNA expression induced by those cytokines in both cell lines
12820724 The anti-MUC2 non-VNTR antibody in the goblet cells of adenomas revealed a staining pattern of increased cytoplasmic, Golgi and membrane staining with no change in goblet vesicle reactivity compared with normal controls
12582180 MUC2 mucin has an autocatalytic cleavage in the C terminus at the low pH of the late secretory pathway
12559945 These results suggest that CDX2, but not CDX1, interacts with the MUC2 promoter and activates MUC2 transcription, and plays an important role in the differentiation of goblet cells.
12527922 The expression of MUC2 gene products in pancreatic cancer cells correlated well with methylation of the proximal region of the promoter
12490305 MUC2 expression in gastric cells is regulated by promoter methylation and further indicate that two specific cytosine guaine dinucleotide (CpG) sites may play a particularly important regulatory role.
12482999 MUC2 gene expression and mucin secretion are regulated by IL1beta
12391274 in human pulmonary epithelial cells, IL-1beta activates ERK or p38 to induce COX-2 production, which in turn induces MUC2 and MUC5AC production.
12374798 increase in expression more signficantly in response to p53 than to p21
12237307 Data show that nontypeable Haemophilus influenzae utilizes the TGF-beta-Smad signaling pathway together with the TLR2-MyD88-TAK1-NIK-IKKbeta/gamma-IkappaBalpha pathway to mediate NF-kappaB-dependent MUC2 mucin transcription.
12218214 MUC2 is a reliable molecular marker for pseudomyxoma peritonei.
12077118 MUC2 upregulated by Phorbol 12-myristate 13-acetate via Ras, ERK, NF-kB
11893907 De novo expression of the Muc2 gene in pancreas carcinoma cells is triggered by promoter demethylation
11813869 MUC2 represents a marker for low-grade dysplasia and the subtype of mucinous carcinomas
11062147 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLPLARLAAVCLALSLAGGSELQTEGRTRYHGRNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGS      1 - 70
YKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSR     71 - 140
AGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPE    141 - 210
EEVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGG    211 - 280
RPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQ    281 - 350
CHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG    351 - 420
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNAVVFKSDGSVLLNQLQVNLPHVTASFSVFRPSSY    421 - 490
HIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQ    491 - 560
STCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCLCA    561 - 630
ALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGC    631 - 700
PDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSN    701 - 770
LTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN    771 - 840
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCG    841 - 910
TTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKL    911 - 980
APSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQ    981 - 1050
CSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIF   1051 - 1120
CDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCY   1121 - 1190
VEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT   1191 - 1260
RPSTLTTFTTITLPTTPTSFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDDGDREPFDGVC   1261 - 1330
GAPEDIECRSVKDPHLSLEQHGQKVQCDVSVGFICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPS   1331 - 1400
PPTTTPSPPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTTTTPPPTTTP   1401 - 1470
SPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPS   1471 - 1540
PPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTT   1541 - 1610
TPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT   1611 - 1680
PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPT   1681 - 1750
TTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAAN   1751 - 1820
ISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTT   1821 - 1890
ENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT   1891 - 1960
GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG   1961 - 2030
TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT   2031 - 2100
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ   2101 - 2170
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT   2171 - 2240
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP   2241 - 2310
TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT   2311 - 2380
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT   2381 - 2450
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT   2451 - 2520
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP   2521 - 2590
ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI   2591 - 2660
TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT   2661 - 2730
TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT   2731 - 2800
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT   2801 - 2870
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT   2871 - 2940
TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT   2941 - 3010
VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV   3011 - 3080
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT   3081 - 3150
PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP   3151 - 3220
TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT   3221 - 3290
PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP   3291 - 3360
TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT   3361 - 3430
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP   3431 - 3500
TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT   3501 - 3570
GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG   3571 - 3640
TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT   3641 - 3710
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ   3711 - 3780
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT   3781 - 3850
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP   3851 - 3920
TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT   3921 - 3990
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT   3991 - 4060
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT   4061 - 4130
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTH   4131 - 4200
TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSP   4201 - 4270
PPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLND   4271 - 4340
TYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPP   4341 - 4410
ECPDFDPPRQENETWWLCDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCY   4411 - 4480
CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLI   4481 - 4550
KTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKG   4551 - 4620
QCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPS   4621 - 4690
PLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAALCAQQNICLDWRNHTHGACLV   4691 - 4760
ECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGEH   4761 - 4830
FEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCP   4831 - 4900
LGFEVKSKMVPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCN   4901 - 4970
TSCSPGFELMEAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNIT   4971 - 5040
CPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSGSCGTFVMYSA   5041 - 5110
KAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG    5111 - 5179
//

Text Mined References (151)

PMID Year Title
25921338 2015 Colonic MUC2 mucin regulates the expression and antimicrobial activity of ?-defensin 2.
25638393 2015 Increased expression of MUC5AC and MUC5B promoting bacterial biofilm formation in chronic rhinosinusitis patients.
25406038 2014 Multiple enzyme approach for the characterization of glycan modifications on the C-terminus of the intestinal MUC2mucin.
25298197 2015 Expression profile of mucins (MUC1, MUC2, MUC5AC, and MUC6) in ovarian mucinous tumours: changes in expression from benign to malignant tumours.
24920497 2014 Meconium ileus in cystic fibrosis is not linked to central repetitive region length variation in MUC1, MUC2, and MUC5AC.
24901817 2014 Gastric mucin expression in first-degree relatives of gastric cancer patients.
24840470 2014 Comprehensive glycomics comparison between colon cancer cell cultures and tumours: implications for biomarker studies.
24816392 2014 Intestinal MUC2 mucin supramolecular topology by packing and release resting on D3 domain assembly.
24714692 2014 Diagnosis of pancreatic neoplasms using a novel method of DNA methylation analysis of mucin expression in pancreatic juice.
24566630 2014 Host inflammatory response inhibits Escherichia coli O157:H7 adhesion to gut epithelium through augmentation of mucin expression.
24478067 2014 Enterotoxigenic Escherichia coli secretes a highly conserved mucin-degrading metalloprotease to effectively engage intestinal epithelial cells.
24478066 2014 EatA, an immunogenic protective antigen of enterotoxigenic Escherichia coli, degrades intestinal mucin.
24324582 2013 High MUC2 expression in ovarian cancer is inversely associated with the M1/M2 ratio of tumor-associated macrophages and patient survival time.
24290360 2014 MUC2 expression is an adverse prognostic factor in superficial gastroesophageal adenocarcinomas.
24280573 MUC2 expression and prevalence of high-grade dysplasia and invasive carcinoma in mixed-type intraductal papillary mucinous neoplasm of the pancreas.
23807779 2013 Expression of MUC2, MUC5AC, MUC5B, and MUC6 mucins in colorectal cancers and their association with the CpG island methylator phenotype.
23619266 PGE(2) induces MUC2 and MUC5AC expression in human intrahepatic biliary epithelial cells via EP4/p38MAPK activation.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23546879 2013 Site-specific O-glycosylation on the MUC2 mucin protein inhibits cleavage by the Porphyromonas gingivalis secreted cysteine protease (RgpB).
23464473 2012 Clinicopathological and prognostic significance of MUC-2, MUC-4 and MUC-5AC expression in japanese gastric carcinomas.
23464457 2012 Hath1 inhibits proliferation of colon cancer cells probably through up-regulating expression of Muc2 and p27 and down-regulating expression of cyclin D1.
23347460 2013 The silence of MUC2 mRNA induced by promoter hypermethylation associated with HBV in Hepatocellular Carcinoma.
23305535 Secretory carcinoma of breast: pattern of MUC 2/MUC 4/MUC 6 expression.
23179399 2013 Loss of MUC2 expression predicts disease recurrence and poor outcome in colorectal carcinoma.
23011828 2012 CDX2, COX2 and MUC2 expressions in Barrett's esophagus: can they be useful in determination of the dysplasia?
22752373 2012 Prognostic relevance of occult metastases detected by cytokeratin 20 and mucin 2 mRNA levels in sentinel lymph nodes from colon cancer patients.
22691042 2012 Notch3 and Jagged2 contribute to gastric cancer development and to glandular differentiation associated with MUC2 and MUC5AC expression.
22582780 2012 Histamine regulates mucin expression through H1 receptor in airway epithelial cells.
22451922 2012 Calcium and pH-dependent packing and release of the gel-forming MUC2 mucin.
22417007 2012 MUC2 polymorphisms are associated with endometriosis development and infertility: a case-control study.
22402132 2012 Genetic variation in MUC1, MUC2 and MUC6 genes and evolution of gastric cancer precursor lesions in a long-term follow-up in a high-risk area in Spain.
22269464 2012 Expression of MUC1, MUC2, MUC5AC and MUC5B in mucinous lesions of the breast.
22261707 2012 Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology: is this evidence of distinct gastric and intestinal pathways to carcinogenesis in Barrett Esophagus?
22116730 2011 [Expression of mucin regulated by recombinant human interleukin-6 in HT-29 cell of colon cancer].
22073249 2011 Up-regulation of MUC2 and IL-1? expression in human colonic epithelial cells by Shigella and its interaction with mucins.
21831773 2010 Lactobacillus and Bifidobacterium species do not secrete protease that cleaves the MUC2 mucin which organises the colon mucus.
21700631 2011 Expression of MUC1 and MUC2 in ampullary cancer.
21647207 2011 Mucin expression pattern in pancreatic diseases: findings from EUS-guided fine-needle aspiration biopsies.
21618511 2012 Lymph node CEA and MUC2 mRNA as useful predictors of outcome in colorectal cancer.
21605079 2011 Suppression of mucin 2 enhances the proliferation and invasion of LS174T human colorectal cancer cells.
21602660 2011 MUC2 is a highly specific marker of goblet cell metaplasia in the distal esophagus and gastroesophageal junction.
21596555 2012 Polymorphisms in MUC1, MUC2, MUC5B and MUC6 genes are not associated with the risk of chronic atrophic gastritis.
21441843 2011 Localization of the most severely dysplastic/invasive lesions and mucin phenotypes in intraductal papillary mucinous neoplasm of the pancreas.
21318237 2011 Modeling the human intestinal mucin (MUC2) C-terminal cystine knot dimer.
21290483 2011 Altered O-glycosylation profile of MUC2 mucin occurs in active ulcerative colitis and is associated with increased inflammation.
21125297 2011 Longitudinal cell formation in the entire human small intestine is correlated with the localization of Hath1 and Klf4.
20929551 2010 Mucins in neoplastic spectrum of colorectal polyps: can they provide predictions?
20878553 2011 MUC2 and MUC6 apomucins expression in human gastric neoplasm: an immunohistochemical analysis.
20873538 2010 [Interleukin-1beta induces MUC2/MUC5B gene expression in human nasal epithelial cells].
20865330 2011 Loss of E-cadherin and MUC2 expressions correlated with poor survival in patients with stages II and III colorectal carcinoma.
20731025 2010 Altered expression of MUC2 and MUC5AC in progression of colorectal carcinoma.
20718712 2010 Sodium butyrate induces differentiation of gastric cancer cells to intestinal cells via the PTEN/phosphoinositide 3-kinase pathway.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485009 2010 Gene expression profiling of colorectal mucinous adenocarcinomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198339 2010 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20198318 2010 MUC2 gene promoter methylation in mucinous and non-mucinous colorectal cancer tissues.
20065027 2010 Two atypical enteropathogenic Escherichia coli strains induce the production of secreted and membrane-bound mucins to benefit their own growth at the apical surface of human mucin-secreting intestinal HT29-MTX cells.
19815850 2010 MUC2 mucin is a major carrier of the cancer-associated sialyl-Tn antigen in intestinal metaplasia and gastric carcinomas.
19718741 2010 Mucin gene polymorphisms in otitis media patients.
19432394 2009 Proteomic analyses of the two mucus layers of the colon barrier reveal that their main component, the Muc2 mucin, is strongly bound to the Fcgbp protein.
19359471 2009 The protein disulfide isomerase AGR2 is essential for production of intestinal mucus.
19321523 2009 A complex, but uniform O-glycosylation of the human MUC2 mucin from colonic biopsies analyzed by nanoLC/MSn.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19246635 2009 Small intestinal MUC2 synthesis in human preterm infants.
19201396 2009 Macrophage-derived interleukin-6 up-regulates MUC1, but down-regulates MUC2 expression in the human colon cancer HT-29 cell line.
19119477 2009 The potential of cytokeratin 20 and mucin 2 mRNA as metastasis markers in regional lymph nodes of colon cancer patients investigated by quantitative RT-PCR.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
18825309 2008 Cadherin-catenin adhesion system and mucin expression: a comparison between young and older patients with gastric carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566135 2008 Campylobacter jejuni response to human mucin MUC2: modulation of colonization and pathogenicity determinants.
18487999 2008 MUC2 expression in primary mucinous and nonmucinous adenocarcinoma of the prostate: an analysis of 50 cases on radical prostatectomy.
18301248 2008 High MUC2 immunohistochemical expression is a predictor of poor response to preoperative radiochemotherapy (RCT) in rectal adenocarcinoma.
18300795 2008 Adenomatous and foveolar gastric dysplasia: distinct patterns of mucin expression and background intestinal metaplasia.
18299935 2008 Pseudomyxoma peritonei: is disease progression related to microbial agents? A study of bacteria, MUC2 AND MUC5AC expression in disseminated peritoneal adenomucinosis and peritoneal mucinous carcinomatosis.
18059019 2008 Cathelicidin stimulates colonic mucus synthesis by up-regulating MUC1 and MUC2 expression through a mitogen-activated protein kinase pathway.
18038313 2008 Does HepPar-1 immunoexpression have a role in differential diagnosis of periampullary cancer?
18004654 2008 Glycosylation of the two O-glycosylated domains of human MUC2 mucin in patients transposed with artificial urinary bladders constructed from proximal colonic tissue.
18000536 2007 Rare exonic minisatellite alleles in MUC2 influence susceptibility to gastric carcinoma.
17991319 2007 [Expression and clinical significance of Mucin and E-cadherin in colorectal tumors].
17982272 2007 Biosynthesis of gastrokine-2 in the human gastric mucosa: restricted spatial expression along the antral gland axis and differential interaction with TFF1, TFF2 and mucins.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17674761 2007 [Up-regulation of MUC2 mucin gene in chronic rhinosinusitis].
17659847 2007 Differences in the expression of mucins in various forms of cystitis glandularis.
17509526 2007 Solution structure of the all L- and D-amino acid-substituted mucin 2 epitope peptides.
17471237 2007 Epigenetic regulation (DNA methylation, histone modifications) of the 11p15 mucin genes (MUC2, MUC5AC, MUC5B, MUC6) in epithelial cancer cells.
17401217 Mucin expression profile in Barrett's, dysplasia, adenocarcinoma sequence in the esophagus.
17333267 2007 Expression of aberrant mucins in lobular carcinoma with histiocytoid feature of the breast.
17321686 2007 Mucolytic activity of bacterial and human chitinases.
17203232 2007 Intestinal MUC2 and gastric M1/MUC5AC in preneoplastic lesions induced by 1,2-dimethylhydrazine in rat: a sequential analysis.
17058067 2006 Aberrant intestinal expression and allelic variants of mucin genes associated with inflammatory bowel disease.
16754877 2006 Entamoeba histolytica cysteine proteases cleave the MUC2 mucin in its C-terminal domain and dissolve the protective colonic mucus gel.
16733847 2006 Relationships between mucinous gastric carcinoma, MUC2 expression and survival.
16721789 2006 MUC2 expression is regulated by histone H3 modification and DNA methylation in pancreatic cancer.
16552339 2006 High expression of intestinal-type mucin (MUC2) in intraductal papillary mucinous neoplasms coexisting with extrapancreatic gastrointestinal cancers.
16475027 2005 MUC1, MUC2, MUC4, MUC5AC and MUC6 expression in the progression of prostate cancer.
16447040 2006 Gastric and intestinal phenotypic cell marker expressions in gastric differentiated-type carcinomas: association with E-cadherin expression and chromosomal changes.
16285957 2005 Galectin-3 modulates MUC2 mucin expression in human colon cancer cells at the level of transcription via AP-1 activation.
16227528 2005 Vasoactive intestinal peptide upregulates MUC2 intestinal mucin via CREB/ATF1.
16188033 2005 Differential expression of MUC genes in endometrial and cervical tissues and tumors.
16142311 2005 Expression of mucin core proteins, trefoil factors, APC and p21 in subsets of colorectal polyps and cancers suggests a distinct pathway of pathogenesis of mucinous carcinoma of the colorectum.
15733066 2005 Expression of human TFF3 in relation to growth of HT-29 cell subpopulations: involvement of PI3-K but not STAT6.
15665513 2005 TNF-alpha activates MUC2 transcription via NF-kappaB but inhibits via JNK activation.
15345696 2004 Adenosine up-regulation of the mucin gene, MUC2, in asthma.
15240568 2004 SOX9 is an intestine crypt transcription factor, is regulated by the Wnt pathway, and represses the CDX2 and MUC2 genes.
15081123 2004 The complete genomic organization of the human MUC6 and MUC2 mucin genes.
15048136 2004 Aberrant expression of CDX2 is closely related to the intestinal metaplasia and MUC2 expression in intraductal papillary neoplasm of the liver in hepatolithiasis.
15000151 Mucins and mucin binding proteins in colorectal cancer.
14678781 2004 Alternative splicing of the human MUC2 gene.
14616551 2003 MUC1 and MUC2 expression in salivary gland tumors and in non-neoplastic salivary gland tissue.
14550542 2003 Viral dsRNA activates mucin transcription in airway epithelial cells.
14525978 2003 Human MUC2 mucin gene is transcriptionally regulated by Cdx homeodomain proteins in gastrointestinal carcinoma cell lines.
12848848 2003 mRNA of MUC2 is stimulated by IL-4, IL-13 or TNF-alpha through a mitogen-activated protein kinase pathway in human colon cancer cells.
12820724 Abnormal subcellular distribution of mature MUC2 and de novo MUC5AC mucins in adenomas of the rectum: immunohistochemical detection using non-VNTR antibodies to MUC2 and MUC5AC peptide.
12582180 2003 An autocatalytic cleavage in the C terminus of the human MUC2 mucin occurs at the low pH of the late secretory pathway.
12559945 2003 Homeodomain protein CDX2 regulates goblet-specific MUC2 gene expression.
12527922 2003 Methylation status of promoters and expression of MUC2 and MUC5AC mucins in pancreatic cancer cells.
12507512 2003 Cloning and characterization of a novel UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, pp-GalNAc-T14.
12490305 2003 Role of site-specific promoter hypomethylation in aberrant MUC2 mucin expression in mucinous gastric carcinomas.
12482999 2002 Interleukin-1beta induces MUC2 gene expression and mucin secretion via activation of PKC-MEK/ERK, and PI3K in human airway epithelial cells.
12417297 2002 Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T10.
12391274 2002 Interleukin-1beta induces MUC2 and MUC5AC synthesis through cyclooxygenase-2 in NCI-H292 cells.
12374798 2002 Transcriptional activation of the MUC2 gene by p53.
12374796 2002 The N terminus of the MUC2 mucin forms trimers that are held together within a trypsin-resistant core fragment.
12237307 2002 Transforming growth factor-beta -Smad signaling pathway cooperates with NF-kappa B to mediate nontypeable Haemophilus influenzae-induced MUC2 mucin transcription.
12218214 2002 MUC2 is a molecular marker for pseudomyxoma peritonei.
12135769 2002 Molecular cloning and characterization of a novel member of the UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase family, pp-GalNAc-T12.
12077118 2002 Phorbol 12-myristate 13-acetate up-regulates the transcription of MUC2 intestinal mucin via Ras, ERK, and NF-kappa B.
11813869 2002 Immunoreactivity of Lewis blood group and mucin peptide core antigens: correlations with grade of dysplasia and malignant transformation in the colorectal adenoma-carcinoma sequence.
11445551 2001 In vivo glycosylation of mucin tandem repeats.
11062147 2000 Polymorphism of human mucin genes in chest disease: possible significance of MUC2.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10336486 1999 Studies on the "insoluble" glycoprotein complex from human colon. Identification of reduction-insensitive MUC2 oligomers and C-terminal cleavage.
9865718 1998 Differential mucin MUC7 gene expression in invasive bladder carcinoma in contrast to uniform MUC1 and MUC2 gene expression in both normal urothelium and bladder carcinoma.
9722984 1998 The MUC2 gene product: a human intestinal mucin.
9668061 1998 Dimerization of the human MUC2 mucin in the endoplasmic reticulum is followed by a N-glycosylation-dependent transfer of the mono- and dimers to the Golgi apparatus.
9407109 1997 The complete cDNA sequence and structural polymorphism of the polypeptide chain of porcine submaxillary mucin.
9224654 1997 Identification and characterization of the MUC2 (human intestinal mucin) gene 5'-flanking region: promoter activity in cultured cells.
9065467 1997 Organization and regulatory aspects of the human intestinal mucin gene (MUC2) locus.
8975711 1996 Human mucin genes assigned to 11p15.5: identification and organization of a cluster of genes.
8300571 1994 Molecular cloning of human intestinal mucin (MUC2) cDNA. Identification of the amino terminus and overall sequence similarity to prepro-von Willebrand factor.
7926500 1994 Biosynthesis of human colonic mucin: Muc2 is the prominent secretory mucin.
7864825 1995 Further evidence that the human MUC2 gene transcripts in the intestine and trachea are identical.
2703501 1989 Molecular cloning of human intestinal mucin cDNAs. Sequence analysis and evidence for genetic polymorphism.
2265829 1990 Assignment of human tracheobronchial mucin gene(s) to 11p15 and a tracheobronchial mucin-related sequence to chromosome 13.
2254452 1990 The core polypeptide of cystic fibrosis tracheal mucin contains a tandem repeat structure. Evidence for a common mucin in airway and gastrointestinal tissue.
1985113 1991 Human bronchus and intestine express the same mucin gene.
1980995 1990 Assignment of the polymorphic intestinal mucin gene (MUC2) to chromosome 11p15.
1885763 1991 MUC-2 human small intestinal mucin gene structure. Repeated arrays and polymorphism.
1550588 1992 Human intestinal mucin-like protein (MLP) is homologous with rat MLP in the C-terminal region, and is encoded by a gene on chromosome 11 p 15.5.
1400449 1992 The human MUC2 intestinal mucin has cysteine-rich subdomains located both upstream and downstream of its central repetitive region.