Property Summary

NCBI Gene PubMed Count 20
PubMed Score 69.57
PubTator Score 19.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26323930 A combination of MUC13/MUC20 expression was a potential prognostic marker for patients with ESCC, who received neoadjuvant chemotherapy followed by surgery.
25672256 Results show that pancreatic ductal adenocarcinoma cells express higher levels of MUC13 and is associated with poor outcome when expressed at low level.
25277192 These results suggest miR-145 as a novel regulator of MUC13 in pancreatic cancer.
25261323 Based on nasopharyngeal MUC13 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants.
25048476 MUC13 is epigenetically regulated in ovarian cancer.
24114056 Overexpression of MUC13 is associated with pancreatic neuroendocrine tumors.
24097071 Overexpression of MUC13 increased cell growth, colony formation, cell migration, and invasion in colon cancer cells.
23708057 GALNT14 may contribute to ovarian carcinogenesis through aberrant glycosylation of MUC13.
22914648 Metastatic colon cancer and liver metastasis tissue samples demonstrated significantly (p<0.05) higher cytoplasmic and nuclear MUC13 expression compared with non-metastatic colon cancer and adjacent normal colon samples.
22027689 MUC13 overexpression caused a significant increase in cell motility, invasion, proliferation, and anchorage-dependent or -independent clonogenicity while decreasing cell-cell and cell-substratum adhesion in pancreatic cancer.
21450906 The various functional domains of MUC13 may confer oncogenic potential to MUC13
19176398 Findings show the aberrant expression of MUC13 in ovarian cancer and that its expression alters the cellular characteristics of SKOV-3 cells. This implies a significant role of MUC13 in ovarian cancer.
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
17058067 Aberrant intestinal expression and allelic variant MUC13 is associated with inflammatory bowel disease.
15904467 MUC13 is a good differentiation marker for gastrointestinal mucosa

AA Sequence

MKAIIHLTLLALLSVNTATNQGNSADAVTTTETATSGPTVAAADTTETNFPETASTTANTPSFPTATSPA      1 - 70
PPIISTHSSSTIPTPAPPIISTHSSSTIPIPTAADSESTTNVNSLATSDIITASSPNDGLITMVPSETQS     71 - 140
NNEMSPTTEDNQSSGPPTGTALLETSTLNSTGPSNPCQDDPCADNSLCVKLHNTSFCLCLEGYYYNSSTC    141 - 210
KKGKVFPGKISVTVSETFDPEEKHSMAYQDLHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADD    211 - 280
KFVNVTIVTILAETTSDNEKTVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDL    281 - 350
QRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQ    351 - 420
LILTIVGTIAGIVILSMIIALIVTARSNNKTKHIEEENLIDEDFQNLKLRSTGFTNLGAEGSVFPKVRIT    421 - 490
ASRDSQMQNPYSRHSSMPRPDY                                                    491 - 512
//

Text Mined References (21)

PMID Year Title
26323930 2015 The expression and prognostic significance of Mucin 13 and Mucin 20 in esophageal squamous cell carcinoma.
25672256 2015 A newly developed anti-Mucin 13 monoclonal antibody targets pancreatic ductal adenocarcinoma cells.
25277192 2014 MicroRNA-145 targets MUC13 and suppresses growth and invasion of pancreatic cancer.
25261323 2015 Nasopharyngeal gene expression, a novel approach to study the course of respiratory syncytial virus infection.
25048476 2014 Overexpression of mucin 13 due to promoter methylation promotes aggressive behavior in ovarian cancer cells.
24114056 2013 Overexpression of membrane proteins in primary and metastatic gastrointestinal neuroendocrine tumors.
24097071 2014 Functions and regulation of MUC13 mucin in colon cancer cells.
23708057 2013 The mucin-type glycosylating enzyme polypeptide N-acetylgalactosaminyltransferase 14 promotes the migration of ovarian cancer by modifying mucin 13.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22914648 2012 Increased expression and aberrant localization of mucin 13 in metastatic colon cancer.
22027689 2012 MUC13 mucin augments pancreatic tumorigenesis.
21450906 2011 Mucin 13: structure, function, and potential roles in cancer pathogenesis.
19176398 2009 Expression and functions of transmembrane mucin MUC13 in ovarian cancer.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
17058067 2006 Aberrant intestinal expression and allelic variants of mucin genes associated with inflammatory bowel disease.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15904467 2005 Overexpression of MUC13 is associated with intestinal-type gastric cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
11278439 2001 Muc13, a novel human cell surface mucin expressed by epithelial and hemopoietic cells.