Property Summary

NCBI Gene PubMed Count 305
PubMed Score 259.13
PubTator Score 385.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.700 8.3e-07
osteosarcoma 1.824 6.9e-05
lung cancer -2.200 2.4e-05
colon cancer 1.100 1.4e-02
ovarian cancer -1.400 1.0e-05

Protein-protein Interaction (2)

Gene RIF (334)

PMID Text
26345779 We aimed to explore the correlation between unexplained recurrent spontaneous abortion and polymorphisms in the methylene tetrahydrofolate reductase (MTHFR) and methionine synthase reductase (MTRR) genes.
26337056 Low folate status and homocysteine metabolism gene polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) may have a synergistic effect towards increasing the incidence of dyslipidemia in Chinese hypertensive population.
26334892 Methionine synthase (MTR) and methionine synthase reductase (MTRR) polymorphisms were significantly associated with the increased neural tube defects risk in a Chinese population.
26316272 an association between MTRR 66 and SHMT1 1420 polymorphisms and spaceflight-induced vision changes
26266420 interactions among homocysteine metabolism gene polymorphisms in MTHFR, MTR and MTRR lead to dramatic elevations in the folate deficiency risk
26252105 MSR 524C/T polymorphism is associated with essential hypertension in ethnic groups in China.
26214647 Review/Meta-analysis: suggest an association between MTRR A66G polymorphism and colorectal cancer susceptibility among Caucasians.
26196053 no association of rs1801394 with non-obstructive azoospermia
26154858 polymorphisms of the MTHFR, MTRR, and MTR enzymes are well documented as folate deficiency-related disorders. The aim of this study was to compare the genotypic distribution of these gene polymorphisms between patients with acromegaly and controls.
26090795 Variation in MTHFR, MTR, and MTRR were significantly associated with percent LINE-1 methylation.DNA methylation of LINE-1 elements in histologically normal breast tissues is influenced by polymorphisms in genes in the one-carbon metabolism pathway
26063524 MTRR genetic polymorphisms are risk factor for predicting cardiovascular manifestations in Marfan syndrome.
26045171 Results identified an allelic variant in the first intron of MTRR that is associated with increased risk of anencephaly in neural tube defects cases.
26037359 The MTHFR 677T and MTRR 66G represent a risk factor for Down syndrome while MTHFR 677T represents a risk factor for Edwards syndrome gestation for Chinese Han females.
26016497 Results from the case-control study and meta-analysis suggest that both of the two polymorphisms MTHFR C677T and MTRR A66G Polymorphisms are not associated with being overweight/obesity
25966116 Findings indicate an association between the single-nucleotide polymorphism A66G in the synthase reductase (MTRR A66G) gene and male infertility, particularly in oligoasthenozoospermia males.
25888933 The findings of this study provide evidence that multiple sclerosis spinal cord simultaneously lack Cbl, EGF, and PrPCs.
25815774 More specifically, variants in methionine synthase reductase (MTRR) are not likely associated with capecitabine efficacy.
25809864 MTRR 66GG genotype showed strong negative association with the risk of childhood brain tumors.
25801727 A decrease of placental expression was noted for MTRR by 50% in pre-eclamptic women as compared to control group.
25754229 association between gene polymorphisms of folate cycle (MTHFR 677 C>T, MTHFR 1298 A>C, MTR 2756 A>G, and MTRR 66 A>G) and the risk of pulmonary embolism (PE)
25578539 We found no evidence for an association between any of these variants (MTHFR C677T and A1298C, MTR A2756G and MTRR A66G) and male infertility
25544792 The MTRR c.66A>G (rs1801394) polymorphism and MTHFD1 c.1958G>A (rs2236225) are associated with increased maternal risk for Down syndrome. [Meta-analysis]
25518505 MTRR A66G polymorphisms have not been found to affect the hemostatic system in adolescents with Essential Hypertension.
25429430 The MTHFR 677T allele may contribute to an increased risk of metabolic syndrome (MetS] in the northern Chinese Han population. The MTRR A66G polymorphism is not associated with MetS.
25337902 Heterogeneity across alcohol consumption status of the associations between MTR/MTRR polymorphisms and these cancers indicates potential interactions between alcohol drinking and one-carbon metabolic pathway
25140779 the SNPs in folate metabolism genes (MTRR and MTHFR) are associated with complex congenital abnormalities and related to ectoderm, mesoderm or endoderm development.
24965145 The MTRR polymorphism represents a risk factor for the birth of a child with Down Syndrome among white Caucasian women. [Meta-analysis]
24913415 meta analysis demonstrated that MTRR A66G polymorphism is a risk factor for congenital heart defects
24815481 MTRR A66G polymorphism was not associated with breast cancer susceptibility.
24595101 This meta-analysis demonstrated a suggestive result that the A66G variant in MTRR, but not the A2756G in MTR, may be associated with the increase of congenital heart disease risks.
24589657 Reciprocal active site substitutions in CPR (H322A) and MSR (A312H) were created. Interflavin electron transfer was inhibited in CPR H322A and accelerated in MSR A312H.
24334125 The distribution of MTHFR A1298C and MTRR A66G genotypes were not different between the fertile and infertile groups.
24261678 This meta-analysis suggests that MTRR A66G GG is associated with decreased risk of leukemia in a Caucasian population and in children, especially for ALL.
24130171 Single nucleotide polymorphism in MTRR gene with LINE-1 methylation is associated with breast cancer.
23986219 A review of the influences of genetic polymorphisms in methionine synthase reductase on the occurrence of adverse effects from methotrexate therapy.
23959833 MTRR A66G gene polymorphism is associated with meningioma.
23459165 The MTHFR C677T polymorphism has significant effects on susceptibility to prostate cancer in Ecuadorian population, especially with the Gleason grade; on the other hand, a significant association between MTHFR A1298C, MTRR A66G, and MTR A2756G with the pathological characteristics was not found (P > 0.05).
23430981 Haplotype analysis suggests an association between MTRR haplotypes and reduced risk of migraine with aura.
23425389 [meta-analysis] MTRR A66G polymorphisms are not associated with risks for neural tube defects in Caucasian children.
23372658 Rs6893114 in MTRR and alcohol consumption are associated with lung cancer risk in current smokers.
23266814 meta-analysis indicated that MTRR A66G polymorphism, but not MTR A2756G, is significantly associated with maternal risk for neural tube defects in Caucasians
23225055 MTHFR gene 677C/T, 1298A/C and MTRR 66A/G polymorphisms in ethnic Han women from Linyi have differed significantly from other regions of China. Decreased MTHFR activity caused by genetic polymorphisms is a risk factor for raised Hcy level.
23188888 Both MTHFR and MTRR gene polymorphisms could be important genetic determinants of serum lipid levels in Chinese patients with hypertension.
23094987 maternal MTRR 66A>G polymorphism is associated with an increased risk of having a DS child.[Meta-Analysis]
23039890 The MTRR+66AA genotype may correlate with the severity of HD.
22925068 genetic association studies in population in China: Data suggest that an SNP in MTRR (C524T; S175L; rs1801394) is associated with decreased risk of Down syndrome in this population.
22813657 MTHFR and MTRR polymorphisms are associated with susceptibility to schizophrenia and support the hypothesis of an association between schizophrenia and folate-homocystiene metabolic pathway genes.
22796266 Results indicate the importance of four gastric cancer susceptibility polymorphisms of IL-10, NOC3L, PSCA and MTRR in the Chinese Han population.
22719222 Meta-analysis suggested that MTHFR 677T allele might provide protection against CRC in worldwide populations, while MTRR 66G allele might increase the risk of CRC in Caucasians.
22706675 MTHFR and MTRR genetic polymorphisms were not associated with childhood ALL. However, AL was positively associated with homozygosity for any of the MTHFR polymorphisms and carriership of both MTRR variant alleles.
22665368 studies suggest that SNPs in CBS and MTRR have sex-specific associations with aberrant methylation in the lung epithelium of smokers that could be mediated by the affected one-carbon metabolism and transsulfuration in the cells
22479380 Data indicate that genetic variants in folate pathway genes showed associations including infant MTRR 66G>A genotype and maternal MTHFR 677C>T genotype with IGF2 methylation.
22475273 The 66GG and AG genotypes were associated with decreased odds ratios for heart defects. This overall association was driven by decreased risk for ventricular septal defect for 66GG and AG and decreased odds ratio for aortic valve stenosis for 66AG.
22373582 Studies suggest that polymorphisms in methylenetetrahydrofolate reductase (MTHFR) and methionine synthase reductase (MTRR) modulate the risk for breast cancer, particularly the A1298C polymorphism of the MTHFR gene.
22339686 Known common single-nucleotide polymorphisms in MTRR and BHMT genes may not be significant risk factors for cororonary artery disease.
22236648 the single-nucleotide polymorphism A66G MTRR is not involved in the development of breast cancer.
22179537 We have demonstrated that the MTRR c.56+781 A>C variant is an important genetic marker for increased congenital heart disease risk because this variant results in functionally reduced MTRR expression at the transcriptional level.
22097960 Data indicate the while W697 in MSR attenuates hydride transfer, it ensures coenzyme selectivity and accelerates FAD to FMN electron transfer (i.e., controls kinetics of interflavin electron transfer).
22057956 MTRR A66G and C524T polymorphisms are associated with increased risk of CHDs.
22005284 Constituents of the folate cycle could be involved in the etiology of idiopathic intellectual disability.
21987236 MTRR A66G and cSHMT C1420T polymorphisms influence CpG island methylator phenotype of BNIP3, thus epigenetically regulating BNIP3 in breast cancer
21947961 The variant allele and genotypic frequencies in MTRR A66G gene was significantly higher in patients with UC compared to healthy controls.
21780915 MTR A2756G polymorphism, but not MTRR A66G and MTHFR A1298C, is associated with risk of coronary heart disease for Europeans.
21775772 MTRR polymorphisms did not appear to be an important genetic factor predisposing to idiopathic infertility in Brazilian men.
21774403 The heterozygous genotype MTRR 66AG was associated with the 5.56-fold increased CL/P risk (OR = 5.56) and for mothers with 2.6-fold increased risk of delivering a CL/P offspring (OR = 2.6).
21603981 These data suggest that all polymorphisms coding for MTHFR, MTR, MTRR and TS have consistent roles in the increased risk of sporadic colorectal adenocarcinoma among the southeastern population of Brazil.
21547363 MTRR A66G polymorphism is a potential biomarker for cancer risk.
21472912 ELDOR spectroscopy was used to identify multiple conformational intermediates in methionine synthase reductase and analyse their relative stabilities.
21438757 Linkage disequilibrium (LD) analysis found possible protective role of MTRR 66 AA in sporadic colon cancer. The significant LD between two loci (MTHFR A1298C and MTRR A66G) located on different chromosomes indicates a selective force for their linkage.
21349258 The genotype and allele frequencies of the MTR Asp919Gly, MTHFR Ala222Val, MTHFD1 Arg653Gln and MTRR Ile22Met gene variants did not display statistical differences between patients with cervical cancer and controls.
21211571 No difference in the distribution between cases and controls was observed for the haplotypes based on the four polymorphisms in the MTRR gene.
21204909 5-Fluorouracil-based chemotherapy for colorectal cancer and MTHFR/MTRR genotypes
21092627 These results suggest that MTRR G66A polymorphism may play a role in coronary artery disease susceptibility.
21070756 the synergistic effects of polymorphisms in the folate metabolic pathway genes in Parkinson's disease susceptibility
21070756 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21055808 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
21045269 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20962453 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20960050 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20955826 The MTHFR 677C>T SNP and the MTRR 66A >G SNP were identified as determinants of impaired bone mineral density (total body) in childhood acute lymphoblastic leukemia patients.
20948192 Observational study of gene-disease association. (HuGE Navigator)
20888556 No association was found between MTHFR/MTRR genetic variants and sperm counts.
20888556 Observational study of gene-disease association. (HuGE Navigator)
20883119 Observational study of gene-disease association. (HuGE Navigator)
20852008 Observational study of gene-disease association. (HuGE Navigator)
20737570 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20726305 study results do not demonstrate an association between A66G MTRR polymorphism and colorectal cancer or breast cancer in Romanian patients
20718043 Observational study of gene-disease association. (HuGE Navigator)
20647221 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615890 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20549016 Germ line polymorphisms in the folate- and methyl-associated genes MTHFR, MTR and MTRR, were analyzed in colorectal cancer patient cohort to find a possible link between these genetic variants and p16 hypermethylation.
20549016 Observational study of gene-disease association. (HuGE Navigator)
20544798 Observational study of gene-disease association. (HuGE Navigator)
20511665 Observational study of gene-disease association. (HuGE Navigator)
20466634 Data show that MTHFR 677C>T and MTRR 66A>G polymorphisms are two independent risk factors for DS pregnancies in young women, but RFC-1 80G>A and MTR 2756A>G polymorphism are not independent risk factor.
20466634 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20447924 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20411324 Meta-analysis strongly suggests that MTRR A66G polymorphism is not associated with breast cancer risk, especially in Caucasians and Asians.
20411324 Meta-analysis of gene-disease association. (HuGE Navigator)
20386493 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
20373852 Observational study of gene-disease association. (HuGE Navigator)
20209990 Patients with hyperhomocysteinemia (HHcy) had statistically significant increase of allele MTHFR 677T and MTRR 66GG as compared both with the control group and with the group of patients without HHcy.
20209990 Observational study of gene-disease association. (HuGE Navigator)
20180013 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20120036 A deep intronic mutation is the direct cause of MTRR pseudoexon inclusion and the pseudoexon is normally not recognized due to a suboptimal 5' splice site.
20099281 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20085490 Meta-analysis of gene-disease association. (HuGE Navigator)
20082058 Observational study of gene-disease association. (HuGE Navigator)
20056620 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20047525 A66G polymorphism not significantly associated with increased risk for neural tube defects
20047525 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20031554 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19936946 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19858780 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19852428 Molecular analysis of 12 genetic polymorphisms involved in the folate metabolism revealed that the mother is heterozygous for the MTHFR C677T and TC2 A67G polymorphisms, and homozygous for the mutant MTRR A66G polymorphism.
19843671 Observational study of gene-disease association. (HuGE Navigator)
19837268 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19812220 Observational study of gene-disease association. (HuGE Navigator)
19777601 Observational study of gene-disease association. (HuGE Navigator)
19776634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19776626 Polymorphisms in methionine synthase, methionine synthase reductase and serine hydroxymethyltransferase, folate and alcohol intake, and colon cancer risk.
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19760026 there was no significant association between most SNPs in methionine synthase reductase , and the risk of cervical intraepithelial neoplasia and cervical cancer in Korean women.
19760026 Observational study of gene-disease association. (HuGE Navigator)
19737740 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19729796 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19706844 Meta-analysis of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19657388 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19533788 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19493349 Observational study of gene-disease association. (HuGE Navigator)
19461557 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of 5-methyltetrahydrofolate-homocysteine methyltransferase reductase (MTRR) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19427504 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19394322 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19353223 Observational study of gene-disease association. (HuGE Navigator)
19348062 MTRR A66G polymorphism was not associated with the total homocysteine plasma concentration because the same genotype frequency distribution was detected in both patients and healthy individuals.
19348062 Observational study of gene-disease association. (HuGE Navigator)
19339913 The MTRR 66A>G gene variant is not associated with peak elevated postoperative plasma total homocysteine after nitrous oxide anesthesia.
19339913 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19336437 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19263808 relationship between occurrence of hyperlipidemia, plasma homocysteine and polymorphisms of methylenetetra hydrofolate reductase (MTHFR) gene and methionine synthase (MS) gene
19254790 In a population with a high prevalence of the mutated T allele, maternal MTRR A66G, but not MTHFR, polymorphisms are associated with Down syndrome.
19254790 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19112534 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064578 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19035314 The MTHFR 1298A>C and the MTRR 66A>G genotypes were associated with an increased risk of hepatocellular carcinoma in this Korean population.
19020309 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19019492 Observational study of gene-disease association. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18988749 Observational study of genetic testing. (HuGE Navigator)
18983896 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18843018 Risk of pancreatic cancer was increased with alcohol consumption in subjects with the MTRR 66 G allele.
18843018 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18842997 Observational study of gene-disease association. (HuGE Navigator)
18836720 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18792976 study evaluated the importance of the polymorphisms in the MTHFR, MTRR, and CBS genes for hyperhomocysteinemia, considering B12 and folate levels; results confirm that genetic interactions can influence on the homocysteine status
18792976 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18785313 Observational study of gene-disease association. (HuGE Navigator)
18774994 The MTRR 66GG and MTHFR 1298 CC genotypes may confer protection against early nephropathy
18774994 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18774170 Observational study of gene-disease association. (HuGE Navigator)
18771981 Observational study of gene-disease association. (HuGE Navigator)
18700049 Observational study of gene-disease association. (HuGE Navigator)
18682255 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18614746 We found a significant interaction between MTHFR 677C-->T and MTRR 66A-->G on serum homocysteine concentrations among non-Hispanic whites.
18614746 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18610829 polymorphic variants of genes GSTT1, GSTM1, NAT2 and MTRR can modulate the risk of childhood acute leukemia, residents of European part of Russia.
18610829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18607581 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18590621 Observational study and meta-analysis of genotype prevalence. (HuGE Navigator)
18515090 Study suggested a common missense SNP of the MTRR gene as a novel pancreatic cancer susceptibility factor with a functional significance in folate-related metabolism and the genome-wide methylation status.
18515090 Observational study of gene-disease association. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18485163 Observational study of gene-disease association. (HuGE Navigator)
18483342 The MTRR A66G and GG genotypes were significantly associated with risk of meningioma but not glioma.
18483342 Observational study of gene-disease association. (HuGE Navigator)
18435414 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)
18386810 Observational study of gene-disease association. (HuGE Navigator)
18378576 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18257130 MTHFR and MTRR gene mutation alleles are related to Down syndrome, and CT, TT and GG gene mutation types increase the risk of Down syndrome
18257130 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18249021 Observational study of gene-disease association. (HuGE Navigator)
18226574 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18222012 Observational study of gene-disease association. (HuGE Navigator)
18221906 MSR protein is restricted to the cytosol but, based on the Leal study, suggest that a similar protein may interact with MMAB to reduce the mitochondrial cobalamin substrate in the generation of adenosylcobalamin
18204969 Observational study of gene-disease association. (HuGE Navigator)
18199722 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18174236 the MTHFR and MTRR polymorphisms are associated with individual susceptibility to breast cancer among postmenopausal women
18174236 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18061941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18034637 The MTRR 66GG genotype was found to be associated with 2.74-fold risk (95% CI: 1.73, 4.34) for deep vein thrombosis among South Indians. This risk is increased further to 3.46-fold (95% CI: 1.38, 8.63) in the presence of the MTHFR 677CT/1298AC genotype.
18034637 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18023275 Observational study of gene-disease association. (HuGE Navigator)
18004208 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17993766 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17993766 These findings suggest that in obese subjects, homocysteine cycle efficiency is impaired by MTHFR, MTR, and MTRR inability to supply methyl-group donors, providing evidence that MTHFR, MTR, and MTRR gene polymorphisms are genetic risk factors for obesity.
17967524 no association between prostate cancer and the MTRR A66C polymorphism
17967524 Observational study of gene-disease association. (HuGE Navigator)
17934692 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
17925002 MTRR polymorphism is related with disease activity in Crohn's disease
17925002 Observational study of gene-disease association. (HuGE Navigator)
17904392 Observational study of gene-disease association. (HuGE Navigator)
17892308 Mechanism of coenzyme binding to human MSR revealed through the crystal structure of the FNR-like module and isothermal titration calorimetry.
17853476 Observational study of gene-disease association. (HuGE Navigator)
17853476 The risk of having a child with congenital malformation or FACS was three to four times higher for mothers who were MTHFR 677TT homozygotes compared with MTHFR 677CC homozygotes
17822659 Observational study of gene-disease association. (HuGE Navigator)
17655928 similar frequencies of the MTHFR, the MTRR and the TYMS genotypes were seen in patients and controls
17655928 Observational study of gene-disease association. (HuGE Navigator)
17636160 Observational study of gene-disease association. (HuGE Navigator)
17611986 In our population of methotrexate (MTX)-treated rheumatoid arthritis patients the 2756GG genotype of the methionine synthase reductase gene was more common than expected and was associated with MTX-induced accelerated rheumatoid nodulosis.
17596206 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17581676 Observational study of gene-disease association. (HuGE Navigator)
17581676 Results suggest that the alterations of folate metabolism related to MTHFR, MTR and MTRR polymorphisms are not involved in clefting in South Brazil.
17554763 methionine synthase reductase modulates the phenotype of a disease-causing mutation
17553479 Observational study of gene-disease association. (HuGE Navigator)
17553479 These results not only highlight the involvement of the MSR and CBS genes in the etiology of cardiovascular disease, but also emphasize the strength of haplotype analyses in association studies.
17546637 Observational study of gene-disease association. (HuGE Navigator)
17546637 MTRR polymorphism may play an important role in the risk of multiple myeloma.
17533396 Observational study of gene-disease association. (HuGE Navigator)
17522601 The interaction between low levels of serum cobalamin and MTHFR (C677T or A1298C) or MTRR A66G gene polymorphisms was associated with increased tHcy.
17522601 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17477549 Structure and function of activation and conformational heterogeneity of recombinant proteins.
17461517 MTRR 2756A > G polymorphisms interact with elevated total homocysteine levels, leading to an increased risk of ischemic stroke.
17454638 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17436311 Observational study of gene-disease association. (HuGE Navigator)
17417062 Since MTR genes are located in 1q43 loci, our findings support the significance of chromosome 1q in etiopathogenesis of bipolar disorder and schizophrenia.
17376725 Observational study of gene-disease association. (HuGE Navigator)
17376725 Distributions for the homozygous mutant form of MTRR were similar between cases and controls, polymorphisim did not increase the risk of placental abruption.
17311260 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17311259 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17220339 Observational study of gene-disease association. (HuGE Navigator)
17152488 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17136115 Observational study of gene-disease association. (HuGE Navigator)
17119116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17113603 Observational study of gene-disease association. (HuGE Navigator)
17101561 Observational study of genetic testing. (HuGE Navigator)
17087642 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17087642 Data indicate that maternal MTRR 66A>G polymorphism is not a risk factor for congenital heart defects (CHD), but maternal MTRR 66GG genotype with compromised vitamin B(12) status may possibly result in increased CHD risk.
17079868 Observational study of gene-disease association. (HuGE Navigator)
17079868 66G/524C haplotype of the MTRR gene affect bone turn over rate.
17074544 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17035141 Observational study of gene-disease association. (HuGE Navigator)
17024475 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17024475 The MTRR polymorphism is a maternal risk factor for spina bifida.
17009228 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16985020 Clinical trial of gene-disease association. (HuGE Navigator)
16947783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16894458 Observational study of gene-disease association. (HuGE Navigator)
16861746 Observational study of gene-disease association. (HuGE Navigator)
16861746 we showed the first genetic evidence that MTHFR C677T, MS A2756G and MTRR A66G genotypes were independently associated with male infertility. Each SNP of the three enzymes may have a different impact on the folate cycle during spermatogenesis
16820193 Observational study of gene-disease association. (HuGE Navigator)
16769880 we propose that MSR serves as a special chaperone for human methionine synthase and as an aquacobalamin reductase, rather than acting solely in the reductive activation of MS
16580699 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16580699 the MTRR AA genotype acts to increase the micronuclei frequency resulting from cigarette smoking
16575899 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16485733 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16470748 Observational study of gene-disease association. (HuGE Navigator)
16351505 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16316363 Observational study of gene-disease association. (HuGE Navigator)
16268464 Observational study of gene-disease association. (HuGE Navigator)
16115349 Observational study of gene-disease association. (HuGE Navigator)
16013960 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16006998 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15979034 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15894670 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15894670 Finds MTRR variant AA genotype associated with a significantly decreased squamous cell head and neck cancer risk.
15889417 Observational study of gene-disease association. (HuGE Navigator)
15866085 Observational study of gene-disease association. (HuGE Navigator)
15797993 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15714522 3 new MTRR mutations (c.7A>T, c.1573C>T, and c.1953-6_1953-2del5) were detected. The identification of mutations in MTRR, & restoration of methionine synthesis following MTRR minigene expression confirms that MTRR gene defects cause cblE homocystinuria.
15612980 Observational study of gene-disease association. (HuGE Navigator)
15612980 SNPs in this enzyme affects homocysteine-regulating genes and may be important determinants of vitamin metabolism in heart transplantation.
15514969 Polymorphisms in the folate metabolic pathway were associated with a lower likelihood of Cervical intrepithelial neoplsia.
15514263 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15514263 findings indicate that when the homozygous variant for the MTHFR 677CT polymorphism coexists with the MTRR 66 AG genotype, plasma homocysteine is significantly elevated relative to the other genotype groups
15354395 Observational study of gene-disease association. (HuGE Navigator)
15347655 Results describe two common polymorphic variants of ATP:cob(I)alamin adenosyltransferase that are found in normal individuals, and their interactions with methionine synthase reductase.
15216546 Observational study of gene-disease association. (HuGE Navigator)
15159311 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15159311 MTRR polymorhism in the genes for folate and methionine metabolism might play a role in the occurance in patient with ALL and NHL.
15135249 Observational study of gene-disease association. (HuGE Navigator)
15059614 Observational study of gene-disease association. (HuGE Navigator)
14977639 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
14967039 Common MSR polymorphisms, I22/L175 and M22/S175, which result in less effective methionine synthase activation, do not have effects on flavin potentials or electron transfer kinetics that would impinge on catalytic efficiency of the variants.
14716779 Observational study of genotype prevalence. (HuGE Navigator)
14652285 Observational study of gene-disease association. (HuGE Navigator)
14632302 Observational study of genotype prevalence. (HuGE Navigator)
12939653 Observational study of gene-disease association. (HuGE Navigator)
12923861 Observational study of gene-disease association. (HuGE Navigator)
12923861 polymorphisms in methionine synthase reductase is associated with increased risk for Down syndrome
12876480 Methionine synthase polymorphism is a risk factor for Alzheimer disease.
12855226 Observational study of gene-disease association. (HuGE Navigator)
12810988 Results of screening mutations 2756A-->G and 66A-->G in MTR and MTRR genes respectively show that are might have an effect on NTDs incidence (neural tube defects).
12807760 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12801615 Observational study of gene-disease association. (HuGE Navigator)
12801615 No differences in mean homocysteine, prevalence of hyperhomocysteinemia and significant coronary artery disease between genotypes AA, AG, GG.
12716294 Observational study of gene-disease association. (HuGE Navigator)
12649067 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12649067 results indicate that MTRR and MTR genes may interact to increase the infants' Neural tube defects risks
12642343 Observational study of gene-disease association. (HuGE Navigator)
12590188 polymorphisms should be regarded as independent risk factors for spina bifida
12482550 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12416982 The kinetic and spectroscopic properties of the M22/S175 and I22/S175 and the I22/L175 and I22/S175 pairs of polymorphic variants of MSR have been compared.
12375236 Variants influence the risk of spina bifida via the maternal rather than the embryonic genotype.
12020105 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11807890 Observational study of gene-disease association. (HuGE Navigator)
11806787 Observational study of gene-disease association. (HuGE Navigator)
11592436 Observational study of gene-disease association. (HuGE Navigator)
11472746 Observational study of gene-disease association. (HuGE Navigator)
10791559 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-environment interaction, and healthcare-related. (HuGE Navigator)

AA Sequence

MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDK      1 - 70
YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDK     71 - 140
RLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSE    141 - 210
LLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVH    211 - 280
LQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSE    281 - 350
VQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHIPAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTS    351 - 420
DSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHP    421 - 490
GKLHFVFNIVEFLSTATTEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPRTTNSFHLP    491 - 560
DDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILT    561 - 630
HLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQIISKEVG    631 - 700
VEKLEAMKTLATLKEEKRYLQDIWS                                                 701 - 725
//

Text Mined References (309)

PMID Year Title
26345779 2015 Polymorphisms in the methylene tetrahydrofolate reductase and methionine synthase reductase genes and their correlation with unexplained recurrent spontaneous abortion susceptibility.
26337056 2015 Joint associations of folate, homocysteine and MTHFR, MTR and MTRR gene polymorphisms with dyslipidemia in a Chinese hypertensive population: a cross-sectional study.
26334892 2015 Analysis of MTR and MTRR Polymorphisms for Neural Tube Defects Risk Association.
26316272 2016 Genotype, B-vitamin status, and androgens affect spaceflight-induced ophthalmic changes.
26266420 2015 Homocysteine Metabolism Gene Polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) Jointly Elevate the Risk of Folate Deficiency.
26252105 2015 [Association of plasma homocysteine level and polymorphism of methione synthase reductase gene with essential hypertension in ethnic Uyghurs and Hans from Xinjiang].
26214647 A meta-analysis of MTRR A66G polymorphism and colorectal cancer susceptibility.
26196053 2015 Association between genetic polymorphisms in folate-related enzyme genes and infertile men with non-obstructive azoospermia.
26154858 2015 An Association Study Between Gene Polymorphisms of Folic Acid Metabolism Enzymes and Biochemical and Hormonal Parameters in Acromegaly.
26090795 2015 Associations between genetic variation in one-carbon metabolism and LINE-1 DNA methylation in histologically normal breast tissues.
26063524 2015 Gene polymorphisms as risk factors for predicting the cardiovascular manifestations in Marfan syndrome. Role of folic acid metabolism enzyme gene polymorphisms in Marfan syndrome.
26045171 2015 Functional variant in methionine synthase reductase intron-1 is associated with pleiotropic congenital malformations.
26037359 2015 [Association of MTHFR and MTRR genes polymorphisms with non-disjunctions of chromosomes 18 and 21].
26016497 2015 Are MTHFR C677T and MTRR A66G Polymorphisms Associated with Overweight/Obesity Risk? From a Case-Control to a Meta-Analysis of 30,327 Subjects.
25966116 2015 Association between methionine synthase reductase A66G polymorphism and primary infertility in Chinese males.
25888933 2015 Low levels of cobalamin, epidermal growth factor, and normal prions in multiple sclerosis spinal cord.
25815774 2015 Clinical validation study of genetic markers for capecitabine efficacy in metastatic colorectal cancer patients.
25809864 2015 Folate pathway gene polymorphisms and risk of childhood brain tumors: results from an Australian case-control study.
25801727 2015 The importance of MTHFR, MTR, MTRR and CSE expression levels in Caucasian women with preeclampsia.
25754229 2015 Association of folate metabolism gene polymorphisms and pulmonary embolism: A case-control study of West-Siberian population.
25578539 2015 Lack of association between genetic polymorphisms in three folate-related enzyme genes and male infertility in the Chinese population.
25544792 2014 Genetic polymorphisms involved in folate metabolism and maternal risk for down syndrome: a meta-analysis.
25518505 2014 [Molecular genetic markers of predisposition to thrombosis in adolescents with essential hypertension ].
25429430 2014 Associations of MTHFR C677T and MTRR A66G gene polymorphisms with metabolic syndrome: a case-control study in Northern China.
25416956 2014 A proteome-scale map of the human interactome network.
25337902 2014 Single nucleotide polymorphisms of one-carbon metabolism and cancers of the esophagus, stomach, and liver in a Chinese population.
25140779 2014 [Association of folate metabolism genes MTRR and MTHFR with complex congenital abnormalities among Chinese population in Shanxi Province, China].
24965145 2014 The MTRR 66A>G polymorphism and maternal risk of birth of a child with Down syndrome in Caucasian women: a case-control study and a meta-analysis.
24913415 2014 Association between methionine synthase reductase A66G polymorphism and the risk of congenital heart defects: evidence from eight case-control studies.
24815481 2014 Methionine synthase reductase A66G polymorphism is not associated with breast cancer susceptibility - a meta-analysis.
24595101 2014 Genetic variant in MTRR, but not MTR, is associated with risk of congenital heart disease: an integrated meta-analysis.
24589657 2014 Proximal FAD histidine residue influences interflavin electron transfer in cytochrome P450 reductase and methionine synthase reductase.
24416422 2014 Nitrite reductase activity and inhibition of H?S biogenesis by human cystathionine ß-synthase.
24334125 2014 Associations of variants in MTHFR and MTRR genes with male infertility in the Jordanian population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24261678 2014 Methionine synthase reductase A66G polymorphism and leukemia risk: evidence from published studies.
24130171 2014 Global DNA methylation and one-carbon metabolism gene polymorphisms and the risk of breast cancer in the Sister Study.
23986219 The influence of genetic RFC1, MS and MTHFR polymorphisms on the risk of acute lymphoblastic leukemia relapse in children and the adverse effects of methotrexate.
23959833 2013 5,10-Methylenetetrahydrofolate reductase (MTHFR), methionine synthase (MTRR), and methionine synthase reductase (MTR) gene polymorphisms and adult meningioma risk.
23459165 2013 Genetic polymorphisms in MTHFR (C677T, A1298C), MTR (A2756G) and MTRR (A66G) genes associated with pathological characteristics of prostate cancer in the Ecuadorian population.
23430981 2013 Haplotype analysis of the folate-related genes MTHFR, MTRR, and MTR and migraine with aura.
23425389 2013 Meta-analyses on the association of MTR A2756G and MTRR A66G polymorphisms with neural tube defect risks in Caucasian children.
23372658 2013 Investigating multiple candidate genes and nutrients in the folate metabolism pathway to detect genetic and nutritional risk factors for lung cancer.
23266814 2013 Association between MTR A2756G and MTRR A66G polymorphisms and maternal risk for neural tube defects: a meta-analysis.
23225055 2012 [Methylenetetrahydrofolate reductase and methionine synthase reductase gene polymorphisms in ethnic Han women from Linyi].
23188888 2014 Associations of MTHFR and MTRR polymorphisms with serum lipid levels in Chinese hypertensive patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23094987 2013 MTRR 66A>G polymorphism as maternal risk factor for Down syndrome: a meta-analysis.
23039890 2012 Association of polymorphisms in DNMT1, DNMT3A, DNMT3B, MTHFR and MTRR genes with global DNA methylation levels and prognosis of autoimmune thyroid disease.
22925068 2013 Functional variant in methionine synthase reductase decreases the risk of Down syndrome in China.
22864933 2012 Identification of novel germline polymorphisms governing capecitabine sensitivity.
22813657 2012 Association between MTHFR C677T and A1298C, and MTRR A66G polymorphisms and susceptibility to schizophrenia in a Syrian study cohort.
22796266 2012 Polymorphisms of tumor-related genes IL-10, PSCA, MTRR and NOC3L are associated with the risk of gastric cancer in the Chinese Han population.
22719222 2012 The polymorphisms in methylenetetrahydrofolate reductase, methionine synthase, methionine synthase reductase, and the risk of colorectal cancer.
22706675 2012 Folic acid supplementation, MTHFR and MTRR polymorphisms, and the risk of childhood leukemia: the ESCALE study (SFCE).
22665368 2012 Sex-specific association of sequence variants in CBS and MTRR with risk for promoter hypermethylation in the lung epithelium of smokers.
22479380 2012 Genetic and non-genetic influences during pregnancy on infant global and site specific DNA methylation: role for folate gene variants and vitamin B12.
22475273 2013 Risk of congenital heart defects is influenced by genetic variation in folate metabolism.
22373582 2012 Association of polymorphisms in one-carbon metabolizing genes with breast cancer risk in Syrian women.
22339686 2012 Folate gene polymorphisms MTR A2756G, MTRR A66G, and BHMT G742A and risk for coronary artery disease: a meta-analysis.
22236648 2012 Polymorphisms in the folate-metabolizing genes MTR, MTRR, and CBS and breast cancer risk.
22179537 2012 Functional variant in methionine synthase reductase intron-1 significantly increases the risk of congenital heart disease in the Han Chinese population.
22097960 2011 Tryptophan 697 modulates hydride and interflavin electron transfer in human methionine synthase reductase.
22057956 2011 A66G and C524T polymorphisms of the methionine synthase reductase gene are associated with congenital heart defects in the Chinese Han population.
22005284 2011 Importance of gene variants and co-factors of folate metabolic pathway in the etiology of idiopathic intellectual disability.
21987236 2012 Bcl-2/adenovirus E1B 19 kDa-interacting protein 3 (BNIP3) expression is epigenetically regulated by one-carbon metabolism in invasive duct cell carcinoma of breast.
21947961 2012 Hyperhomocysteinemia and related genetic polymorphisms correlate with ulcerative colitis in Chinese Han population in Central China [corrected].
21780915 2012 Three genetic polymorphisms of homocysteine-metabolizing enzymes and risk of coronary heart disease: a meta-analysis based on 23 case-control studies.
21775772 2011 Polymorphisms in folate-related enzyme genes in idiopathic infertile Brazilian men.
21774403 [Allelic polymorphism of MTHFR, MTR and MTRR genes in patients with cleft lip and/or palate and their mothers].
21603981 2011 Gene polymorphisms involved in folate and methionine metabolism and increased risk of sporadic colorectal adenocarcinoma.
21547363 2012 Methionine synthase reductase A66G polymorphism contributes to tumor susceptibility: evidence from 35 case-control studies.
21472912 2011 ELDOR spectroscopy reveals that energy landscapes in human methionine synthase reductase are extensively remodelled following ligand and partner protein binding.
21438757 2011 Association of MTHFR, MTR, MTRR, RFC1, and DHFR gene polymorphisms with susceptibility to sporadic colon cancer.
21349258 2011 Folate and choline metabolism gene variants and development of uterine cervical carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21211571 2011 MTHFR and MTRR genotype and haplotype analysis and colorectal cancer susceptibility in a case-control study from the Czech Republic.
21204909 2011 5-Fluorouracil-based chemotherapy for colorectal cancer and MTHFR/MTRR genotypes.
21092627 2010 [Associations of polymorphisms of methionine synthase A2756G and methionine synthase reductase G66A with the risks of coronary artery disease: a meta-analysis].
21070756 2011 Association of MTHFR, MTR, and MTRR polymorphisms with Parkinson's disease among ethnic Chinese in Taiwan.
21055808 2011 Polymorphisms in folate-metabolizing genes and risk of non-Hodgkin's lymphoma.
21045269 2010 Maternal gene polymorphisms involved in folate metabolism as risk factors for Down syndrome offspring in Southern Brazil.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20962453 2011 Interactions of 5'-UTR thymidylate synthase polymorphism with 677C ? T methylene tetrahydrofolate reductase and 66A ? G methyltetrahydrofolate homocysteine methyl-transferase reductase polymorphisms determine susceptibility to coronary artery disease.
20960050 2011 Dietary methyl donors, methyl metabolizing enzymes, and epigenetic regulators: diet-gene interactions and promoter CpG island hypermethylation in colorectal cancer.
20955826 2011 Germline variation in the MTHFR and MTRR genes determines the nadir of bone density in pediatric acute lymphoblastic leukemia: a prospective study.
20948192 2010 The G allele of transcobalamin 2 c.776C?G is associated with an unfavorable lipoprotein profile.
20888556 2011 Polymorphisms in MTHFR and MTRR genes associated with blood plasma homocysteine concentration and sperm counts.
20883119 2011 Common polymorphisms in six genes of the methyl group metabolism pathway and obesity in European adolescents.
20852008 2010 Associations of folate, vitamin B12, homocysteine, and folate-pathway polymorphisms with prostate-specific antigen velocity in men with localized prostate cancer.
20737570 2010 Genetic variants in one-carbon metabolism-related genes contribute to NSCLC prognosis in a Chinese population.
20726305 MTRR polymorphism and the risk for colorectal and breast cancer in Romanian patients--a preliminary study.
20718043 2010 Variation in folate pathway genes contributes to risk of congenital heart defects among individuals with Down syndrome.
20647221 2011 Associations of various gene polymorphisms with toxicity in colorectal cancer patients receiving oral uracil and tegafur plus leucovorin: a prospective study.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615890 2010 A candidate gene study of folate-associated one carbon metabolism genes and colorectal cancer risk.
20549016 MTHFR, MTR, and MTRR polymorphisms in relation to p16INK4A hypermethylation in mucosa of patients with colorectal cancer.
20544798 2010 Genetic and lifestyle variables associated with homocysteine concentrations and the distribution of folate derivatives in healthy premenopausal women.
20511665 2010 Candidate gene association studies and risk of childhood acute lymphoblastic leukemia: a systematic review and meta-analysis.
20466634 2010 [Folate gene polymorphism and the risk of Down syndrome pregnancies in young Chinese women].
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20447924 2010 Plasma folate, related genetic variants, and colorectal cancer risk in EPIC.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20411324 2010 MTRR A66G polymorphism and breast cancer risk: a meta-analysis.
20386493 2010 Polymorphisms within the folate pathway predict folate concentrations but are not associated with disease activity in rheumatoid arthritis patients on methotrexate.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20373852 2010 Microarray-based detection of CYP1A1, CYP2C9, CYP2C19, CYP2D6, GSTT1, GSTM1, MTHFR, MTRR, NQO1, NAT2, HLA-DQA1, and AB0 allele frequencies in native Russians.
20209990 2009 [Features of allele polymorphism of genes involved in homocysteine and folate metabolism in patients with atherosclerosis of the lower extremity arteries].
20180013 2010 Genetic polymorphisms in folate and alcohol metabolism and breast cancer risk: a case-control study in Thai women.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20120036 2010 The deep intronic c.903+469T>C mutation in the MTRR gene creates an SF2/ASF binding exonic splicing enhancer, which leads to pseudoexon activation and causes the cblE type of homocystinuria.
20099281 2010 Blood leukocyte DNA hypomethylation and gastric cancer risk in a high-risk Polish population.
20085490 2010 Genetic variants of homocysteine/folate metabolism pathway and risk of inflammatory bowel disease: a synopsis and meta-analysis of genetic association studies.
20082058 2010 Transcobalamin-II variants, decreased vitamin B12 availability and increased risk of frailty.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056620 2010 Vitamins B2 and B6 and genetic polymorphisms related to one-carbon metabolism as risk factors for gastric adenocarcinoma in the European prospective investigation into cancer and nutrition.
20047525 2010 Role of parental folate pathway single nucleotide polymorphisms in altering the susceptibility to neural tube defects in South India.
20031554 2008 Variants of folate metabolism genes and the risk of conotruncal cardiac defects.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19936946 2010 Germline polymorphisms in the one-carbon metabolism pathway and DNA methylation in colorectal cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19858780 2009 Gene-gene interactions in folate and adenosine biosynthesis pathways affect methotrexate efficacy and tolerability in rheumatoid arthritis.
19852428 2009 Double aneuploidy (48,XXY,+21) of maternal origin in a child born to a 13-year-old mother: evaluation of the maternal folate metabolism.
19843671 2009 Genetic variants of methyl metabolizing enzymes and epigenetic regulators: associations with promoter CpG island hypermethylation in colorectal cancer.
19837268 2009 Polymorphisms in one-carbon metabolism pathway genes and risk for bladder cancer in a Tunisian population.
19812220 2009 Body mass index is an important determinant of methylation biomarkers in women of reproductive ages.
19777601 2010 Variants of folate metabolism genes and risk of left-sided cardiac defects.
19776634 2009 Folate nutritional genetics and risk for hypertension in an elderly population sample.
19776626 2008 Polymorphisms in methionine synthase, methionine synthase reductase and serine hydroxymethyltransferase, folate and alcohol intake, and colon cancer risk.
19774638 2010 Pharmacogenomic variations in treatment protocols for childhood acute lymphoblastic leukemia.
19760026 2010 The effects of polymorphisms in methylenetetrahydrofolate reductase (MTHFR), methionine synthase (MTR), and methionine synthase reductase (MTRR) on the risk of cervical intraepithelial neoplasia and cervical cancer in Korean women.
19737740 2010 Associations of folate and choline metabolism gene polymorphisms with orofacial clefts.
19729796 2009 Investigation of CBS, MTR, RFC-1 and TC polymorphisms as maternal risk factors for Down syndrome.
19706844 2009 Association of folate-pathway gene polymorphisms with the risk of prostate cancer: a population-based nested case-control study, systematic review, and meta-analysis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19657388 2009 Lack of association between genetic polymorphisms in enzymes associated with folate metabolism and unexplained reduced sperm counts.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19533788 2009 Evaluation of folate metabolism gene polymorphisms as risk factors for open and closed neural tube defects.
19493349 2009 118 SNPs of folate-related genes and risks of spina bifida and conotruncal heart defects.
19461557 2009 Genetic polymorphisms relevant for one-carbon metabolism show no effect on homocysteine plasma levels and DNA methylation in alcoholism.
19427504 2009 Effect of common polymorphisms in folate uptake and metabolism genes on frequency of micronucleated lymphocytes in a South Australian cohort.
19394322 2009 Genetic and environmental influences on total plasma homocysteine and coronary artery disease (CAD) risk among South Indians.
19353223 2009 Genetic variants of methionine metabolism and X-ALD phenotype generation: results of a new study sample.
19348062 2009 Methionine synthase reductase (MTRR) A66G polymorphism is not related to plasma homocysteine concentration and the risk for vascular disease.
19339913 2009 A common gene variant in methionine synthase reductase is not associated with peak homocysteine concentrations after nitrous oxide anesthesia.
19336437 2009 Vasculopathic and thrombophilic risk factors for spontaneous preterm birth.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19263808 2008 Plasma homocysteine and gene polymorphisms associated with the risk of hyperlipidemia in northern Chinese subjects.
19254790 2009 Maternal polymorphisms for methyltetrahydrofolate reductase and methionine synthetase reductase and risk of children with Down syndrome.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19112534 2008 Lack of association of polymorphisms in homocysteine metabolism genes with pseudoexfoliation syndrome and glaucoma.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064578 2008 No association of single nucleotide polymorphisms in one-carbon metabolism genes with prostate cancer risk.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
19035314 Methylenetetrahydrofolate reductase (MTHFR) and methionine synthase reductase (MTRR) gene polymorphisms as risk factors for hepatocellular carcinoma in a Korean population.
19020309 2009 Polymorphisms in folate-related genes and risk of pediatric acute lymphoblastic leukemia.
19019492 2010 Genetic variation in homocysteine metabolism, cognition, and white matter lesions.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18988749 2009 MALDI-TOF MS genotyping of polymorphisms related to 1-carbon metabolism using common and mass-modified terminators.
18983896 2009 Association of maternal polymorphisms in folate metabolizing genes with chromosome damage and risk of Down syndrome offspring.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18843018 2008 Alcohol drinking and one-carbon metabolism-related gene polymorphisms on pancreatic cancer risk.
18842997 2008 Methionine-dependence phenotype in the de novo pathway in BRCA1 and BRCA2 mutation carriers with and without breast cancer.
18836720 2009 Prothrombotic polymorphisms, mutations, and their association with pediatric non-cardioembolic stroke in Asian-Indian patients.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18792976 2008 Polymorphisms in the CBS gene and homocysteine, folate and vitamin B12 levels: association with polymorphisms in the MTHFR and MTRR genes in Brazilian children.
18785313 2008 Functional polymorphisms of folate-metabolizing enzymes in relation to homocysteine concentrations in systemic lupus erythematosus.
18774994 2008 Methylenetetrahydrofolate reductase and methionine synthase reductase gene polymorphisms and protection from microvascular complications in adolescents with type 1 diabetes.
18774170 2009 Association between polymorphisms of folate-metabolizing enzymes and hematological malignancies.
18771981 2008 One-carbon metabolism enzyme polymorphisms and uteroplacental insufficiency.
18700049 2008 Methionine synthase A2756G polymorphism may predict ulcerative colitis and methylenetetrahydrofolate reductase C677T pancolitis, in Central China.
18682255 2009 Arsenic metabolism is influenced by polymorphisms in genes involved in one-carbon metabolism and reduction reactions.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18614746 2008 Prevalence and effects of gene-gene and gene-nutrient interactions on serum folate and serum total homocysteine concentrations in the United States: findings from the third National Health and Nutrition Examination Survey DNA Bank.
18610829 [Genetic polymorphism in GST, NAT2, and MTRR and susceptibility to childhood acute leukemia].
18607581 2008 Genetic determinants of methotrexate toxicity in rheumatoid arthritis patients: a study of polymorphisms affecting methotrexate transport and folate metabolism.
18590621 2008 [Analysis of the frequencies of genotype combinations of 4 polymorphisms of genes acting on the folate cycle in the Spanish population].
18515090 2008 His595Tyr polymorphism in the methionine synthase reductase (MTRR) gene is associated with pancreatic cancer risk.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18485163 2008 Folic acid use in pregnancy and embryo selection.
18483342 2008 Functional polymorphisms in folate metabolism genes influence the risk of meningioma and glioma.
18435414 2008 Polymorphisms in genes related to folate and cobalamin metabolism and the associations with complex birth defects.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18386810 2008 Nutritional and genetic determinants of vitamin B and homocysteine metabolisms in neural tube defects: a multicenter case-control study.
18378576 2008 Coagulation gene predictors of photodynamic therapy for occult choroidal neovascularization in age-related macular degeneration.
18257130 2008 Polymorphisms in genes involved in folate metabolism as maternal risk factors for Down syndrome in China.
18249021 2008 Total homocysteine, B-vitamins and genetic polymorphisms in patients with classical phenylketonuria.
18226574 2008 Genetic and lifestyle factors related to the periconception vitamin B12 status and congenital heart defects: a Dutch case-control study.
18222012 2008 Methylenetetrahydrofolate reductase 677 T allele protects against persistent HBV infection in West Africa.
18221906 2008 Restricted role for methionine synthase reductase defined by subcellular localization.
18204969 2008 Polymorphisms in folate metabolizing enzymes and transport proteins and the risk of breast cancer.
18199722 2008 Dietary vitamin B6 intake and the risk of colorectal cancer.
18174236 2008 One-carbon metabolism-related gene polymorphisms and risk of breast cancer.
18061941 2008 Polymorphisms in xenobiotic-metabolizing genes and the risk of chronic lymphocytic leukemia and non-Hodgkin's lymphoma in adult Russian patients.
18034637 2008 Relationship between methionine synthase, methionine synthase reductase genetic polymorphisms and deep vein thrombosis among South Indians.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18023275 2008 Evaluation of nutritional and genetic determinants of total homocysteine, methylmalonic acid and S-adenosylmethionine/S-adenosylhomocysteine values in Brazilian childbearing-age women.
18004208 2007 Predictive role of coagulation-balance gene polymorphisms in the efficacy of photodynamic therapy with verteporfin for classic choroidal neovascularization secondary to age-related macular degeneration.
17993766 2007 Are genetic variants of the methyl group metabolism enzymes risk factors predisposing to obesity?
17967524 2008 Association between polymorphisms of folate-metabolizing enzymes and risk of prostate cancer.
17934692 2007 Maternal gene polymorphisms involved in folate metabolism and risk of Down syndrome offspring: a meta-analysis.
17925002 2008 Association of MTRR 66A>G polymorphism with superoxide dismutase and disease activity in patients with Crohn's disease.
17904392 2008 A high frequency of the MTHFR 677C>T polymorphism in Scottish women with epilepsy: possible role in pathogenesis.
17892308 2007 Mechanism of coenzyme binding to human methionine synthase reductase revealed through the crystal structure of the FNR-like module and isothermal titration calorimetry.
17853476 2007 Fetal anticonvulsant syndromes and polymorphisms in MTHFR, MTR, and MTRR.
17822659 2007 Relation between plasma homocysteine, gene polymorphisms of homocysteine metabolism-related enzymes, and angiographically proven coronary artery disease.
17655928 2008 Polymorphisms of methylenetetrahydrofolate reductase (MTHFR), methionine synthase (MTR), methionine synthase reductase (MTRR), and thymidylate synthase (TYMS) in multiple myeloma risk.
17636160 2007 The heritability of plasma homocysteine, and the influence of genetic variation in the homocysteine methylation pathway.
17611986 2007 2756GG genotype of methionine synthase reductase gene is more prevalent in rheumatoid arthritis patients treated with methotrexate and is associated with methotrexate-induced nodulosis.
17596206 2007 One-carbon metabolism-related gene polymorphisms and risk of head and neck squamous cell carcinoma: case-control study.
17581676 2007 Polymorphisms in genes MTHFR, MTR and MTRR are not risk factors for cleft lip/palate in South Brazil.
17554763 2007 Polymorphic background of methionine synthase reductase modulates the phenotype of a disease-causing mutation.
17553479 2007 A CBS haplotype and a polymorphism at the MSR gene are associated with cardiovascular disease in a Spanish case-control study.
17546637 2007 Polymorphisms involved in the folate metabolizing pathway and risk of multiple myeloma.
17533396 2007 Prognostic significance of folate metabolism polymorphisms for lung cancer.
17522601 2008 Association between decreased vitamin levels and MTHFR, MTR and MTRR gene polymorphisms as determinants for elevated total homocysteine concentrations in pregnant women.
17477549 2007 Protein interactions in the human methionine synthase-methionine synthase reductase complex and implications for the mechanism of enzyme reactivation.
17461517 2007 Influence of combined methionine synthase (MTR 2756A > G) and methylenetetrahydrofolate reductase (MTHFR 677C > T) polymorphisms to plasma homocysteine levels in Korean patients with ischemic stroke.
17454638 2007 Gene-gene interactions in the folate metabolic pathway influence the risk for acute lymphoblastic leukemia in children.
17436311 2007 Large-scale population-based metabolic phenotyping of thirteen genetic polymorphisms related to one-carbon metabolism.
17417062 2007 MTHFD 1958G>A and MTR 2756A>G polymorphisms are associated with bipolar disorder and schizophrenia.
17376725 2007 Polymorphisms in methionine synthase reductase and betaine-homocysteine S-methyltransferase genes: risk of placental abruption.
17369066 2007 Metabolic derangement of methionine and folate metabolism in mice deficient in methionine synthase reductase.
17311260 2007 Genetic polymorphisms in the one-carbon metabolism pathway and breast cancer risk: a population-based case-control study and meta-analyses.
17311259 2007 Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer.
17220339 2007 Genetic polymorphisms in folate metabolism and the risk of stomach cancer.
17152488 2006 [Association between genetic polymorphisms in folate metabolic enzyme genes and colorectal cancer: a nested case-control study].
17136115 2007 Folate metabolic gene polymorphisms and childhood acute lymphoblastic leukemia: a case-control study.
17119116 2007 Gene-nutrient interactions among determinants of folate and one-carbon metabolism on the risk of non-Hodgkin lymphoma: NCI-SEER case-control study.
17113603 2007 No association between MTHFR A1298C and MTRR A66G polymorphisms, and MS in an Australian cohort.
17101561 2006 Detection of MTRR 66A-->G polymorphism using the real-time polymerase chain reaction machine LightCycler for determination of composition of allele after restriction cleavage.
17087642 2006 MTRR 66A>G polymorphism in relation to congenital heart defects.
17079868 2006 Methionine synthase reductase polymorphisms are associated with serum osteocalcin levels in postmenopausal women.
17074544 2006 Polymorphisms in folate metabolizing genes and risk for spontaneous preterm and small-for-gestational age birth.
17035141 2006 Neural tube defects and folate pathway genes: family-based association tests of gene-gene and gene-environment interactions.
17024475 2006 The methionine synthase reductase 66A>G polymorphism is a maternal risk factor for spina bifida.
17009228 2006 Pharmacogenomic and metabolic biomarkers in the folate pathway and their association with methotrexate effects during dosage escalation in rheumatoid arthritis.
16985020 2006 Folate metabolism polymorphisms influence risk of colorectal adenoma recurrence.
16947783 2006 Relationship between genetic variants in the adenosine pathway and outcome of methotrexate treatment in patients with recent-onset rheumatoid arthritis.
16894458 2006 Association of homocysteine (but not of MTHFR 677 C>T, MTR 2756 A>G, MTRR 66 A>G and TCN2 776 C>G) with ischaemic cerebrovascular disease in Sicily.
16861746 2006 Association study of four polymorphisms in three folate-related enzyme genes with non-obstructive male infertility.
16820193 2007 Polymorphism C776G in the transcobalamin II gene and homocysteine, folate and vitamin B12 concentrations. Association with MTHFR C677T and A1298C and MTRR A66G polymorphisms in healthy children.
16769880 2006 Human methionine synthase reductase is a molecular chaperone for human methionine synthase.
16580699 2006 A polymorphism of the methionine synthase reductase gene increases chromosomal damage in peripheral lymphocytes in smokers.
16575899 2006 Maternal polymorphisms 677C-T and 1298A-C of MTHFR, and 66A-G MTRR genes: is there any relationship between polymorphisms of the folate pathway, maternal homocysteine levels, and the risk for having a child with Down syndrome?
16485733 2006 Influence of methionine synthase (A2756G) and methionine synthase reductase (A66G) polymorphisms on plasma homocysteine levels and relation to risk of coronary artery disease.
16470748 2006 Study of four genes belonging to the folate pathway: transcobalamin 2 is involved in the onset of non-syndromic cleft lip with or without cleft palate.
16351505 2005 Folate, vitamin B6, vitamin B12, and vitamin B2 intake, genetic polymorphisms of related enzymes, and risk of colorectal cancer in a hospital-based case-control study in Japan.
16316363 2005 Effects of single-nucleotide polymorphisms in MTHFR and MTRR on mortality and allograft loss in kidney transplant recipients.
16268464 2005 Association of MTRRA66G polymorphism (but not of MTHFR C677T and A1298C, MTRA2756G, TCN C776G) with homocysteine and coronary artery disease in the French population.
16115349 2005 No association between common polymorphisms in genes of folate and homocysteine metabolism and the risk of Down's syndrome among French mothers.
16013960 2005 Polymorphisms of genes controlling homocysteine levels and IQ score following the treatment for childhood ALL.
16006998 2005 Polymorphisms of methionine synthase and methionine synthase reductase and risk of lung cancer: a case-control analysis.
15979034 2005 Analysis of methionine synthase reductase polymorphisms for neural tube defects risk association.
15894670 2005 Polymorphisms of methionine synthase and methionine synthase reductase and risk of squamous cell carcinoma of the head and neck: a case-control analysis.
15889417 2005 Relationship between polymorphisms in genes involved in homocysteine metabolism and maternal risk for Down syndrome in Brazil.
15866085 2005 Polymorphisms of genes involved in homocysteine metabolism in preeclampsia and in uncomplicated pregnancies.
15797993 2005 Effect of polymorphisms in folate-related genes on in vitro methotrexate sensitivity in pediatric acute lymphoblastic leukemia.
15714522 2005 cblE type of homocystinuria due to methionine synthase reductase deficiency: functional correction by minigene expression.
15612980 2005 Genetic polymorphisms predisposing to hyperhomocysteinemia in cardiac transplant patients.
15514969 2005 Women with polymorphisms of methylenetetrahydrofolate reductase (MTHFR) and methionine synthase (MS) are less likely to have cervical intraepithelial neoplasia (CIN) 2 or 3.
15514263 2004 Methionine synthase reductase 66A->G polymorphism is associated with increased plasma homocysteine concentration when combined with the homozygous methylenetetrahydrofolate reductase 677C->T variant.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15354395 2004 Methyltetrahydrofolate reductase polymorphism influences onset of Huntington's disease.
15347655 2004 Human ATP:Cob(I)alamin adenosyltransferase and its interaction with methionine synthase reductase.
15216546 2004 Polymorphisms in the methylenetetrahydrofolate reductase and methionine synthase reductase genes and homocysteine levels in Brazilian children.
15159311 2004 Common gene polymorphisms in the metabolic folate and methylation pathway and the risk of acute lymphoblastic leukemia and non-Hodgkin's lymphoma in adults.
15135249 2004 Methionine synthase reductase MTRR 66A > G has no effect on total homocysteine, folate, and Vitamin B12 concentrations in renal transplant patients.
15059614 2004 Low erythrocyte folate status and polymorphic variation in folate-related genes are associated with risk of neural tube defect pregnancy.
14977639 2004 Polymorphisms in genes involved in folate metabolism and colorectal neoplasia: a HuGE review.
14967039 2004 Kinetic and thermodynamic characterization of the common polymorphic variants of human methionine synthase reductase.
14716779 2004 Genetic polymorphisms in the Hmong population: implications for cancer etiology and survival.
14652285 2003 Esophageal and gastric cardia cancer risk and folate- and vitamin B(12)-related polymorphisms in Linxian, China.
14632302 2003 Genotype frequencies and linkage disequilibrium in the CEPH human diversity panel for variants in folate pathway genes MTHFR, MTHFD, MTRR, RFC1, and GCP2.
12939653 2003 Genetic polymorphisms in folate and homocysteine metabolism as risk factors for DNA damage.
12923861 2003 Methionine synthase (MTR) 2756 (A --> G) polymorphism, double heterozygosity methionine synthase 2756 AG/methionine synthase reductase (MTRR) 66 AG, and elevated homocysteinemia are three risk factors for having a child with Down syndrome.
12876480 2003 Methionine synthase polymorphism is a risk factor for Alzheimer disease.
12855226 2003 Interaction between common folate polymorphisms and B-vitamin nutritional status modulates homocysteine and risk for a thrombotic event.
12810988 [Mutations of MTHFR, MTR, MTRR genes as high risk factors for neural tube defects].
12807760 2003 Folate status, metabolic genotype, and biomarkers of genotoxicity in healthy subjects.
12801615 2003 Methylenetetrahydrofolate reductase (MTHFR) 677C>T and methionine synthase reductase (MTRR) 66A>G polymorphisms: association with serum homocysteine and angiographic coronary artery disease in the era of flour products fortified with folic acid.
12716294 2002 Methionine Synthase Reductase Gene A66G Polymorphism is Associated with Risk of Colorectal Cancer.
12649067 2003 Homocysteine remethylation enzyme polymorphisms and increased risks for neural tube defects.
12642343 2003 Genetic and nutritional factors contributing to hyperhomocysteinemia in young adults.
12590188 2003 Polymorphisms of the 5,10-methylenetetrahydrofolate and the methionine synthase reductase genes as independent risk factors for spina bifida.
12555939 2002 CblE type of homocystinuria due to methionine synthase reductase deficiency: clinical and molecular studies and prenatal diagnosis in two families.
12482550 2003 Effects of polymorphisms of methionine synthase and methionine synthase reductase on total plasma homocysteine in the NHLBI Family Heart Study.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12416982 2002 Differences in the efficiency of reductive activation of methionine synthase and exogenous electron acceptors between the common polymorphic variants of human methionine synthase reductase.
12375236 2002 Maternal genetic effects, exerted by genes involved in homocysteine remethylation, influence the risk of spina bifida.
12020105 2002 B-vitamin intake, metabolic genes, and colorectal cancer risk (United States).
11807890 2002 MTRR and MTHFR polymorphism: link to Down syndrome?
11806787 2001 Genetics University of Toronto Thrombophilia Study in Women (GUTTSI): genetic and other risk factors for venous thromboembolism in women.
11592436 2001 Genetic defects as important factors for moderate hyperhomocysteinemia.
11472746 2001 The methionine synthase reductase (MTRR) A66G polymorphism is a novel genetic determinant of plasma homocysteine concentrations.
11466310 2001 Human methionine synthase reductase, a soluble P-450 reductase-like dual flavoprotein, is sufficient for NADPH-dependent methionine synthase activation.
10791559 2000 5,10-Methylenetetrahydrofolate reductase gene variants and congenital anomalies: a HuGE review.
10564814 1999 Molecular cloning, expression and physical mapping of the human methionine synthase reductase gene.
10500018 1999 Abnormal folate metabolism and mutation in the methylenetetrahydrofolate reductase gene may be maternal risk factors for Down syndrome.
10484769 1999 Molecular basis for methionine synthase reductase deficiency in patients belonging to the cblE complementation group of disorders in folate/cobalamin metabolism.
10444342 1999 A common variant in methionine synthase reductase combined with low cobalamin (vitamin B12) increases risk for spina bifida.
9501215 1998 Cloning and mapping of a cDNA for methionine synthase reductase, a flavoprotein defective in patients with homocystinuria.