Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.75
PubTator Score 7.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 2.1e-05
psoriasis 6694 7.1e-05
ovarian cancer 8520 1.6e-04
dermatomyositis 966 2.2e-03
Multiple myeloma 1332 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.035 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.100 2.2e-03
lung cancer 1.600 2.1e-05
Multiple myeloma 1.278 2.0e-02
ovarian cancer 2.200 1.6e-04
psoriasis 1.600 7.1e-05

Gene RIF (5)

AA Sequence

MNQKLLKLENLLRFHTIYRQLHSLCQRRALRQWRHGFSSAYPVWTAQLCAWPWPTDVLTGAALSQYRLLV      1 - 70
TKKEEGPWKSQLSSTKSKKVVEVWIGMTIEELARAMEKNTDYVYEALLNTDIDIDSLEADSHLDEVWIKE     71 - 140
VITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRSPVVTIMGHVDHGKTTLLDKFRKTQVAAVET    141 - 210
GGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQ    211 - 280
VPIILAVNKCDKAEADPEKVKKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKAD    281 - 350
PNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITG    351 - 420
WRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRS    421 - 490
ILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDASHECELELVHFGVGDVSAND    491 - 560
VNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVEDLQEELSSRLPCAVEEHPVGEASILA    561 - 630
TFSVTEGKKKVPVAGCRVQKGQLEKQKKFKLTRNGHVIWKGSLTSLKHHKDDISIVKTGMDCGLSLDEDN    631 - 700
MEFQVGDRIVCYEEKQIQAKTSWDPGF                                               701 - 727
//

Text Mined References (19)

PMID Year Title