Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.75
PubTator Score 7.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 2.1e-05
psoriasis 6685 7.1e-05
ovarian cancer 8491 1.6e-04
dermatomyositis 966 2.2e-03
Multiple myeloma 1327 2.0e-02
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.017 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.278 2.0e-02
psoriasis 1.600 7.1e-05
lung cancer 1.600 2.1e-05
ovarian cancer 2.200 1.6e-04
dermatomyositis 1.100 2.2e-03

Gene RIF (5)

PMID Text
24166409 This study identified a novel GWS association (1.17 x 10(-10)) mapped to chromosome 2 at rs1437396, between MTIF2 and CCDC88A, across all of the EA and AA cohorts.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20468071 Observational study of gene-disease association. (HuGE Navigator)
19209188 Meta-analysis of gene-disease association. (HuGE Navigator)
18051367 HIV-1 NC downregulates mitochondrial translational initiation factor 2 in HEK 293T cells

AA Sequence

MNQKLLKLENLLRFHTIYRQLHSLCQRRALRQWRHGFSSAYPVWTAQLCAWPWPTDVLTGAALSQYRLLV      1 - 70
TKKEEGPWKSQLSSTKSKKVVEVWIGMTIEELARAMEKNTDYVYEALLNTDIDIDSLEADSHLDEVWIKE     71 - 140
VITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRSPVVTIMGHVDHGKTTLLDKFRKTQVAAVET    141 - 210
GGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQ    211 - 280
VPIILAVNKCDKAEADPEKVKKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKAD    281 - 350
PNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITG    351 - 420
WRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRS    421 - 490
ILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDASHECELELVHFGVGDVSAND    491 - 560
VNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVEDLQEELSSRLPCAVEEHPVGEASILA    561 - 630
TFSVTEGKKKVPVAGCRVQKGQLEKQKKFKLTRNGHVIWKGSLTSLKHHKDDISIVKTGMDCGLSLDEDN    631 - 700
MEFQVGDRIVCYEEKQIQAKTSWDPGF                                               701 - 727
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24166409 2014 Genome-wide association study of alcohol dependence:significant findings in African- and European-Americans including novel risk loci.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
19209188 2009 Genetic association analysis of 13 nuclear-encoded mitochondrial candidate genes with type II diabetes mellitus: the DAMAGE study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17416734 2007 The balance between protein synthesis and degradation in chloroplasts determines leaf variegation in Arabidopsis yellow variegated mutants.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
12932832 2003 The human mitochondrial translation initiation factor 2 gene (MTIF2): transcriptional analysis and identification of a pseudogene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095986 2002 Identification of mammalian mitochondrial translational initiation factor 3 and examination of its role in initiation complex formation with natural mRNAs.
9925935 1998 Assignment1 of the mitochondrial translational initiation factor 2 gene (MTIF2) to human chromosome 2 bands p16-->p14 by in situ hybridization and with somatic cell hybrids.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7829522 1995 Cloning and sequence analysis of the human mitochondrial translational initiation factor 2 cDNA.