Property Summary

NCBI Gene PubMed Count 17
PubMed Score 20.43
PubTator Score 2.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE      1 - 70
AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP     71 - 140
IDRSVDFLLDSSLRKLYPTVGKPSSS                                                141 - 166
//

Text Mined References (19)

PMID Year Title