Property Summary

NCBI Gene PubMed Count 88
PubMed Score 90.52
PubTator Score 201.04

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (61)

PMID Text
26538561 Mst1 increases the acetylation of Foxp3 by inhibiting Sirt1 activity, which requires the Mst1 kinase activity.
26056943 results suggest that the decreased expression of MST1 in regulatory T cells due to hypermethylation of the promoter contributes to the pathogenesis of IgG4-related AIP
25704570 Elevated serum levels of MST1 were found in subjects with excessive alcohol use.
25551685 Identify MST1/MSP as a mitogen for tracheal basal cells.
25373346 Results suggest that Mst1 regulates proliferation of glioma cells via AKT/mTOR signaling pathway
25315688 MSP appears to promote the migration of fibroblasts, enhances collagen synthesis and remodeling, and effectively improves wound healing.
25193665 These results support the hypothesis that the alpha-chain of MSPalphabeta mediates RON dimerization.
24976283 MST1 protein gene expression is a prognostic indicator for patients diagnosed with colorectal cancer.
24881775 Hippo and Yap regulate cardiomyocyte death and regeneration.
24872389 hMOB3 modulates MST1 apoptotic signaling and supports tumor growth in glioblastoma multiforme.
24841766 Our data unveiled the role of MST1 as a negative feedback for TGFbeta1 and EGFregulated endometrial cancer cell invasiveness, migration and proliferation.
24499724 MYC, in concert with EZH2, epigenetically attenuates MST1 expression and suggest that the loss of MST1/Hippo functions is critical for the MYC or EZH2 mediation of cancer cell survival.
24409221 functional consequences of the macrophage stimulating protein 689C inflammatory bowel disease risk allele
24141421 results suggest that Mst1 coordinately regulates autophagy and apoptosis by phosphorylating Beclin1 and consequently modulating a three-way interaction among Bcl-2 proteins, Beclin1 and Bax
23928732 Mst1 has an important role in inhibiting the growth of NSCLC in vitro and in vivo; its antiproliferative effect is associated with induction of apoptosis.
23893242 Phosphorylated by the MST1.
23737290 MST1 plays a tumor suppressive role and is a prognostic factor in human breast cancer.
23527007 In a yeast two-hybrid screen of a heart cDNA library with Mst1 as bait, glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was identified as an Mst1-interacting protein.
23422030 Results suggest that the [AA] genotype of the common MST1 variant rs3197999 enhances genetic risk of sporadic extrahepatic cholangiocarcinoma irrespective of primary sclerosing cholangitis status.
23386615 Mst1 inactivates Prdx1 by phosphorylating it at Thr-90 and Thr-183, leading to accumulation of hydrogen peroxide in cells.
23347832 Mst1 exhibits a growth promoting activity in HCC cells upon NORE1B downregulation.
23011677 MSP may be one of the major determinants that affects the properties of tumor stroma and that produces a permissive microenvironment to promote cancer metastasis
22554193 The present results refine the known genetic architecture in primary sclerosing cholangitis by confirming MST1 locus association.
22245154 HAT cleaves proMSP at the physiological activation site
22087277 the missense SNP impairs MSP function by reducing its affinity to RON and perhaps through a secondary effect on in vivo concentration arising from reduced thermodynamic stability, resulting in down-regulation of the MSP/RON signaling pathway.
21931648 Studies indicate that the cylindromatosis/turban tumor syndrome gene (CYLD) ranked highest, followed by acylaminoacyl-peptidase (APEH), dystroglycan (DAG1), macrophage-stimulating protein (MST1) and ubiquitin-specific peptidase 4 (USP4).
21875933 These findings suggest that the MSP/RON signaling pathway may be regulated by hepsin in tissue homeostasis and in disease pathologies, such as in cancer and immune disorders.
21723047 considerable number of Merkel cell carcinoma cases expressed both RON and MSP, while Merkel cells do not express these molecules
21619683 MSP-induced RSK2 activation is a critical determinant linking RON signaling to cellular EMT program.
21249150 the oncogenic effect of BRAF(V600E) is associated with the inhibition of MST1 tumor suppressor pathways, and that the activity of RASSF1A-MST1-FoxO3 pathways determines the phenotypes of BRAF(V600E) tumors.
21228115 Phage microarrays containing colorectal cancer cDNA libraries were prepared to identify phage-expressed peptides recognized by tumor-specific autoantibodies from patient sera.
21212262 novel regulatory mechanism involving the phosphorylation of Sirt1 by MST1 kinase which leads to p53 activation, with implications for our understanding of signaling mechanisms during DNA damage-induced apoptosis
21081472 results suggest that MSP induces uPAR expression via MAPK, AP-1 and NF-kappaB signaling pathways
21072187 Observational study of gene-disease association. (HuGE Navigator)
20921231 H2AX is a substrate of MST1, which functions to induce apoptotic chromatin condensation and DNA fragmentation
20513427 The identified Mst1 as a binding partner that interacts with PHLPPs both in vivo and in vitro. PHLPPs dephosphorylate Mst1 on the T387 inhibitory site, which activate Mst1 and its downstream effectors p38 and JNK to induce apoptosis.
20307617 Observational study of gene-disease association. (HuGE Navigator)
20171103 MST1 directly phosphorylated Aurora B and inhibited its kinase activity in vitro; depletion of Aurora B restored the stability of kinetochore-microtubule attachment in cells depleted of MST1 or NDR1.
20024904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20014019 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956688 tolerance to increased levels of intracellular ROS provided by the Mst1-FoxOs signaling pathway is crucial for the maintenance of naive T cell homeostasis in the periphery
19950692 hSav1 is a newly identified protein that interacts with Mst1 and augments Mst1-mediated apoptosis.
19944697 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19861958 Observational study of gene-disease association. (HuGE Navigator)
19836237 MST1 and hMOB1 signaling controls centrosome duplication.
19760754 Observational study of gene-disease association. (HuGE Navigator)
19657358 The effect of BSN-MST1 locus on Crohn's disease predisposition was replicated, but no influence on ulcerative colitis or multiple sclerosis predisposition could be detected
19657358 Observational study of gene-disease association. (HuGE Navigator)
19456860 Results suggest that hepatocyte growth factor activator is a major serum activator of pro-macrophage-stimulating protein.
19221179 MST1-FOXO1 signaling is an important link survival factor deprivation-induced neuronal cell death
19212654 hWW45 is required to enhance MST1-mediated apoptosis in vivo and thus is a critical player in an MST1-driven cell death signaling pathway.
19079170 Gene-centric association mapping of chromosome 3p implicates MST1 in IBD pathogenesis.
18700007 The five gene transcripts (aldolase B, elafin, MST-1, simNIPhom and SLC6A14) were changed in patients with ulcerative colitis, and were related to the disease activity.
18480548 Cell migration and production of inflammatory cytokines by the brain are enhanced by MSP stimulation in primary microglia.
18438406 Observational study of gene-disease association. (HuGE Navigator)
17456594 overexpression of MSP, MT-SP1, and MST1R was a strong independent indicator of both metastasis and death in human breast cancer
16170349 repression of MSP gene expression by mutant p53 may contribute to oncogenesis in a cell type-specific manner
15764806 Macrophage stimulating protein and its receptor RON are involved in the pathophysiology of endometriosis.
14597639 macrophage-stimulating protein-responsive cell growth in culture is suppressed by the ron-sema domain
12919677 Data show that macrophage stimulating protein (MSP) and its receptor (Ron) induce phosphorylation of both Ron and alpha6beta4 integrin, and result in activation of alpha3beta1 integrin.
12177064 These results suggest that activation of RON by macrophage-stimulating protein inhibits LPS-induced macrophage Cox-2 expression.

AA Sequence

MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFH      1 - 70
YNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPN     71 - 140
DHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGR    141 - 210
ECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATT    211 - 280
VSCFRGKGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGM    281 - 350
RAAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCR    351 - 420
NPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGHPG    421 - 490
NSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKM    491 - 560
VCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQ    561 - 630
ECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVF    631 - 700
VDWIHKVMRLG                                                               701 - 711
//

Text Mined References (93)

PMID Year Title
26538561 2015 Mammalian Sterile 20-like Kinase 1 (Mst1) Enhances the Stability of Forkhead Box P3 (Foxp3) and the Function of Regulatory T Cells by Modulating Foxp3 Acetylation.
26056943 2015 Hypermethylation of MST1 in IgG4-related autoimmune pancreatitis and rheumatoid arthritis.
25704570 2015 Novel serum biomarkers for detection of excessive alcohol use.
25551685 2014 Cell surface marker profiling of human tracheal basal cells reveals distinct subpopulations, identifies MST1/MSP as a mitogenic signal, and identifies new biomarkers for lung squamous cell carcinomas.
25373346 2015 Mst1 regulates glioma cell proliferation via the AKT/mTOR signaling pathway.
25315688 2015 The effects of macrophage-stimulating protein on the migration, proliferation, and collagen synthesis of skin fibroblasts in vitro and in vivo.
25193665 2014 Structural basis for the binding specificity of human Recepteur d'Origine Nantais (RON) receptor tyrosine kinase to macrophage-stimulating protein.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24976283 Expression of hippo pathway in colorectal cancer.
24881775 2014 Harnessing Hippo in the heart: Hippo/Yap signaling and applications to heart regeneration and rejuvenation.
24872389 2014 hMOB3 modulates MST1 apoptotic signaling and supports tumor growth in glioblastoma multiforme.
24841766 2014 Mammalian sterile-like 1 kinase inhibits TGF? and EGF?dependent regulation of invasiveness, migration and proliferation of HEC-1-A endometrial cancer cells.
24499724 2014 Overexpression of MYC and EZH2 cooperates to epigenetically silence MST1 expression.
24409221 2013 Functional consequences of the macrophage stimulating protein 689C inflammatory bowel disease risk allele.
24141421 2013 Mst1 inhibits autophagy by promoting the interaction between Beclin1 and Bcl-2.
23928732 2013 Mst1 overexpression inhibited the growth of human non-small cell lung cancer in vitro and in vivo.
23893242 2014 Scaffold attachment factor B1 regulates the androgen receptor in concert with the growth inhibitory kinase MST1 and the methyltransferase EZH2.
23737290 2013 Prognostic significance of mammalian sterile 20-like kinase 1 in breast cancer.
23527007 2013 Glyceraldehyde-3-phosphate dehydrogenase interacts with proapoptotic kinase mst1 to promote cardiomyocyte apoptosis.
23422030 2013 Macrophage stimulating protein variation enhances the risk of sporadic extrahepatic cholangiocarcinoma.
23386615 2013 The tumor suppressor Mst1 promotes changes in the cellular redox state by phosphorylation and inactivation of peroxiredoxin-1 protein.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23347832 2013 Full-length Mst1 exhibits growth promoting function in human hepatocellular carcinoma cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23011677 2013 Macrophage stimulating protein promotes liver metastases of small cell lung cancer cells by affecting the organ microenvironment.
22554193 2012 Fine mapping and replication of genetic risk loci in primary sclerosing cholangitis.
22245154 2012 Activation of macrophage-stimulating protein by human airway trypsin-like protease.
22087277 2011 Protein characterization of a candidate mechanism SNP for Crohn's disease: the macrophage stimulating protein R689C substitution.
21931648 2011 Genetic evidence supporting the association of protease and protease inhibitor genes with inflammatory bowel disease: a systematic review.
21875933 2011 Proteolytic activation of pro-macrophage-stimulating protein by hepsin.
21723047 2011 Tyrosine kinase receptor RON and its ligand MSP in Merkel cell carcinoma.
21619683 2011 Ribosomal protein S6 kinase (RSK)-2 as a central effector molecule in RON receptor tyrosine kinase mediated epithelial to mesenchymal transition induced by macrophage-stimulating protein.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21249150 2011 Cross-regulation between oncogenic BRAF(V600E) kinase and the MST1 pathway in papillary thyroid carcinoma.
21228115 2011 Identification of MST1/STK4 and SULF1 proteins as autoantibody targets for the diagnosis of colorectal cancer by using phage microarrays.
21212262 2011 MST1 promotes apoptosis through regulating Sirt1-dependent p53 deacetylation.
21151127 2011 Genome-wide association analysis in primary sclerosing cholangitis identifies two non-HLA susceptibility loci.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21081472 2011 MSP-induced RON activation upregulates uPAR expression and cell invasiveness via MAPK, AP-1 and NF-?B signals in gastric cancer cells.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20921231 2010 MST1 promotes apoptosis through phosphorylation of histone H2AX.
20513427 2010 Mst1 is an interacting protein that mediates PHLPPs' induced apoptosis.
20307617 2010 Association analysis of 3p21 with Crohn's disease in a New Zealand population.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20171103 2010 MST1 limits the kinase activity of aurora B to promote stable kinetochore-microtubule attachment.
20024904 2010 Variants at the 3p21 locus influence susceptibility and phenotype both in adults and early-onset patients with inflammatory bowel disease.
20014019 2010 Genome wide association (GWA) predictors of anti-TNFalpha therapeutic responsiveness in pediatric inflammatory bowel disease.
19956688 2009 Mst1-FoxO signaling protects Naïve T lymphocytes from cellular oxidative stress in mice.
19950692 2009 [Overexpression of hSav1 promotes Mst1-induced apoptosis in HeLa cells].
19944697 2010 Genome-wide association analysis in primary sclerosing cholangitis.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
19836237 2009 The MST1 and hMOB1 tumor suppressors control human centrosome duplication by regulating NDR kinase phosphorylation.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19720831 2009 Hepatocyte growth factor family negatively regulates hepatic gluconeogenesis via induction of orphan nuclear receptor small heterodimer partner in primary hepatocytes.
19657358 2009 Effect of BSN-MST1 locus on inflammatory bowel disease and multiple sclerosis susceptibility.
19456860 2009 Hepatocyte growth factor activator is a serum activator of single-chain precursor macrophage-stimulating protein.
19221179 2009 Regulation of neuronal cell death by MST1-FOXO1 signaling.
19212654 2009 The human WW45 protein enhances MST1-mediated apoptosis in vivo.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19079170 2008 Gene-centric association mapping of chromosome 3p implicates MST1 in IBD pathogenesis.
18700007 2008 Five mucosal transcripts of interest in ulcerative colitis identified by quantitative real-time PCR: a prospective study.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18480548 2008 Regulation of cell migration and cytokine production by HGF-like protein (HLP) / macrophage stimulating protein (MSP) in primary microglia.
18438406 2008 Genetic determinants of ulcerative colitis include the ECM1 locus and five loci implicated in Crohn's disease.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17554261 2007 Sequence variants in the autophagy gene IRGM and multiple other replicating loci contribute to Crohn's disease susceptibility.
17456594 2007 The macrophage-stimulating protein pathway promotes metastasis in a mouse model for breast cancer and predicts poor prognosis in humans.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16279944 2005 Crystal structure of the beta-chain of human hepatocyte growth factor-like/macrophage stimulating protein.
16170349 2006 Repression of the MSP/MST-1 gene contributes to the antiapoptotic gain of function of mutant p53.
15764806 2005 The macrophage stimulating protein/RON system: a potential novel target for prevention and treatment of endometriosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14597639 2004 The soluble sema domain of the RON receptor inhibits macrophage-stimulating protein-induced receptor activation.
12919677 2003 The MSP receptor regulates alpha6beta4 and alpha3beta1 integrins via 14-3-3 proteins in keratinocyte migration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12177064 2002 Activation of the RON receptor tyrosine kinase by macrophage-stimulating protein inhibits inducible cyclooxygenase-2 expression in murine macrophages.
11856768 2002 Macrophage-stimulating protein is produced by tubular cells and activates mesangial cells.
11274154 2001 alpha 1-Antichymotrypsin is the human plasma inhibitor of macrophage ectoenzymes that cleave pro-macrophage stimulating protein.
10728827 1998 Structure of the human D1F15S1A locus: a chromosome 1 locus with 97% identity to the chromosome 3 gene coding for hepatocyte growth factor-like protein.
10068459 1999 Characterization of free alpha- and beta-chains of recombinant macrophage-stimulating protein.
9202013 1997 Macrophage stimulating protein (MSP) binds to its receptor via the MSP beta chain.
9045873 1997 Role of macrophage-stimulating protein and its receptor, RON tyrosine kinase, in ciliary motility.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8702870 1996 The Ste20-like protein kinase, Mst1, dimerizes and contains an inhibitory domain.
8621550 1996 Hepatocyte nuclear factor-4 is responsible for the liver-specific expression of the gene coding for hepatocyte growth factor-like protein.
8393443 1993 Cloning, sequencing, and expression of human macrophage stimulating protein (MSP, MST1) confirms MSP as a member of the family of kringle proteins and locates the MSP gene on chromosome 3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7508914 1994 Proteolytic conversion of single chain precursor macrophage-stimulating protein to a biologically active heterodimer by contact enzymes of the coagulation cascade.
2902784 1988 Regional localization of chromosome 3-specific DNA fragments by using a hybrid cell deletion mapping panel.
1827141 1991 Macrophage stimulating protein: purification, partial amino acid sequence, and cellular activity.
1655021 1991 Characterization of the DNF15S2 locus on human chromosome 3: identification of a gene coding for four kringle domains with homology to hepatocyte growth factor.