Property Summary

NCBI Gene PubMed Count 92
PubMed Score 297.25
PubTator Score 626.24

Knowledge Summary

Patent

No data available

Gene RIF (64)

AA Sequence

MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC      1 - 70
TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII                               71 - 114
//

Text Mined References (93)

PMID Year Title