Property Summary

NCBI Gene PubMed Count 92
PubMed Score 297.25
PubTator Score 626.24

Knowledge Summary

Patent

No data available

Synonym

Accession P08118 B1API6 P11999 Q13125 Q6IAY9 Q9UC59
Symbols MSP
PSP
IGBF
MSPB
PN44
PRPS
HPC13
PSP57
PSP94
PSP-94

Gene

PANTHER Protein Class (2)

PDB

2IZ3   3IX0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (64)

AA Sequence

MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC      1 - 70
TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII                               71 - 114
//

Text Mined References (93)

PMID Year Title