Property Summary

NCBI Gene PubMed Count 34
PubMed Score 40.74
PubTator Score 36.49

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (4)

Gene RIF (24)

PMID Text
27121842 MSI2 directly attenuates aryl hydrocarbon receptor (AHR) signalling through post-transcriptional downregulation of canonical AHR pathway components in cord blood haematopoietic stem and progenitor cells
26673327 Concomitant loss of function of both MSI1 is sufficient to abrogate the growth of human colorectal cancer cells, and Msi gene deletion inhibits tumorigenesis in several mouse models of intestinal cancer.
25851660 This review highlights both the essential contribution of RBPs to posttranscriptional regulation and the importance of the Musashi family as master regulators of male gamete development--{REVIEW}
25774828 the MSI2 RNA-binding protein has a role in transformation of intestinal epithelium
25664853 MSI2 controls efficient translation of the oncogenic leukemic stem cell self-renewal program.
25449073 Acute myeloid leukemia patients have a higher level of MSI2 gene expression.
25380226 Msi proteins contribute to an epithelial gene expression program in neural and mammary cell types.
25363400 Up-regulated MSI2 is associated with more aggressive chronic myeloid leukemia.
25090928 These results confirm the association of MSI2 expression with outcome in adult B-ALL and demonstrate the utility of MSI2 as a clinical prognostic biomarker.
24305552 MSI2 correlates with epithelial-mesenchymal transition and has the potential to be a new predictive biomarker of hepatocellular carcinoma prognosis and invasion.
24076374 The Msi2 plays an important role in leukemogenesis involving the MAPK signaling pathway, which indicates that Msi2 may be a novel target for leukemia treatment.
24002004 Report a statistical difference between the MSI2 gene expression in different gastric tumor grades, of note between grade I and grade II.
23759245 Data suggest that high MSI2 expression could indicate poor prognosis and facilitate risk and treatment stratification in adult BCR-ABL-negative B-cells acute lymphoblastic leukemia (B-ALL).
23667531 a large set of SOX2-associated proteins in DAOY medulloblastoma cells
23233047 MSI2 is associated with shorter overall survival in acute myeloid leukemia patients.
22784712 Down-modulation of MSI2 is associated with myelodysplastic syndromes and acute myeloid leukemia.
22113197 Overexpression of MSI2 resulted in a decrease in MSI1 expression.
21753187 High MSI2 is associated with acute myeloid leukemia.
20823875 MSI2 has a crucial role in both normal and malignant hematopoiesis.
20639863 Msi2 expression is not only highly upregulated during human chronic myeloid leukemia progression but is also an early indicator of poorer prognosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18815193 The EVI1 gene locus was rearranged in all 13 myeloid malignancies patients and was associated with EVI1 overexpression. In 9 out of 13 patients, the 17q breakpoints clustered in a 250 kb region on band 17q22 encompassing the MSI2 gene

AA Sequence

MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA      1 - 70
DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM     71 - 140
LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF    141 - 210
MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG    211 - 280
PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH                          281 - 328
//

Text Mined References (40)

PMID Year Title
27121842 2016 Musashi-2 attenuates AHR signalling to expand human haematopoietic stem cells.
26673327 2015 The Msi Family of RNA-Binding Proteins Function Redundantly as Intestinal Oncoproteins.
25851660 RNA binding proteins in spermatogenesis: an in depth focus on the Musashi family.
25774828 2015 Transformation of the intestinal epithelium by the MSI2 RNA-binding protein.
25664853 2015 Musashi2 sustains the mixed-lineage leukemia-driven stem cell regulatory program.
25449073 2014 [Expression of Musashi2 gene in de novo acute myeloid leukemia and its clinical implications].
25416956 2014 A proteome-scale map of the human interactome network.
25380226 2014 Musashi proteins are post-transcriptional regulators of the epithelial-luminal cell state.
25363400 2015 Up-regulated MSI2 is associated with more aggressive chronic myeloid leukemia.
25090928 2015 Prognostic significance of MSI2 predicts unfavorable outcome in adult B-acute lymphoblastic leukemia.
24305552 2014 Musashi2 predicts poor prognosis and invasion in hepatocellular carcinoma by driving epithelial-mesenchymal transition.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24076374 2014 Musashi2 modulates K562 leukemic cell proliferation and apoptosis involving the MAPK pathway.
24002004 2013 MSI2 expression is decreased in grade II of gastric carcinoma.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23759245 2013 High expression of Musashi-2 indicates poor prognosis in adult B-cell acute lymphoblastic leukemia.
23667531 2013 The SOX2-interactome in brain cancer cells identifies the requirement of MSI2 and USP9X for the growth of brain tumor cells.
23233047 2013 Prognostic significance of expression levels of stem cell regulators MSI2 and NUMB in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22784712 2012 Distinct expression profiles of MSI2 and NUMB genes in myelodysplastic syndromes and acute myeloid leukemia patients.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22113197 2011 Musashi expression in ?-cells coordinates insulin expression, apoptosis and proliferation in response to endoplasmic reticulum stress in diabetes.
21753187 2011 MSI2 protein expression predicts unfavorable outcome in acute myeloid leukemia.
21269460 2011 Initial characterization of the human central proteome.
20823875 2010 A cancer fate in the hands of a samurai.
20639863 2010 Regulation of myeloid leukaemia by the cell-fate determinant Musashi.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18815193 2008 EVI1 overexpression in t(3;17) positive myeloid malignancies results from juxtaposition of EVI1 to the MSI2 locus at 17q22.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12649177 2003 A novel gene, MSI2, encoding a putative RNA-binding protein is recurrently rearranged at disease progression of chronic myeloid leukemia and forms a fusion gene with HOXA9 as a result of the cryptic t(7;17)(p15;q23).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11588182 2001 Rna-binding protein Musashi2: developmentally regulated expression in neural precursor cells and subpopulations of neurons in mammalian CNS.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.