Property Summary

NCBI Gene PubMed Count 85
PubMed Score 256.66
PubTator Score 122.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.3e-03

Protein-protein Interaction (3)

Gene RIF (64)

PMID Text
26617824 Our meta-analysis results demonstrated that MSH3 rs26279 G > A polymorphism is associated with an increased risk of overall cancer, especially for the colorectal cancer and breast cancer.
26212458 The mismatch-binding protein MutS beta, a heterodimer of MSH2 and MSH3, activates ATR in response to DNA double-strand breaks.
25966119 Data show that single nucleotide polymorphisms in MutS homolog 3 (MSH3) had an impact on the chemotherapy response and prognosis of advanced non-small cell lung cancer (NCSLC) patients who were treated with platinum-based chemotherapy.
25598504 Our data present, for the first time, evidence that inherited MLH1 c.-93G>A, MSH2 c.211 + 9C>G, MSH3 c.3133G>A, and EXO1 c.1765G>A abnormalities of DNA MMR pathway are important determinants of head and neck squamous cell carcinoma
25461668 IL6 signaling disrupts the nuclear localization of hMSH3 and DNA repair, leading to elevated microsatellite alterations at selected tetranucleotide repeats in cancer cell lines.
24934723 Methylation of MSH3 together with exposure to tobacco smoke is involved in esophageal carcinogenesis.
23724141 MSH3 status can regulate the DNA damage response and extent of apoptosis induced by chemotherapy.
23339595 Single nucleotide polymorphisms in MSH3 are associated with myelodysplastic syndromes.
23226332 Oxidative stress, which causes a shift of hMSH3's subcellular location, may contribute to an hMSH3 loss-of-function phenotype by sequestering it to the cytosol
22941650 siRNA knockdown of the MutSbeta subunits MSH2 or MSH3 impeded expansion of threshold-length CTG*CAG repeats.
22343000 The binding of HIF-1alpha complexes to hypoxia response element sites is necessary for down-regulation of hMSH3 in both wt-p53 and mut-p53 cells.
22249440 The high frequency of loss of heterozygosity as well as the aberrant protein expression in some tumors indicates an involvement of MSH3 impairment in colorectal cancer with low-level microsatellite instability.
22179786 Studies indicate thar eukaryotes MutSbeta, a heterodimer of Msh2 and Msh3, recognizes insertion-deletion loops (IDLs) of 1-15 nucleotides, as well as DNA with a 3' single-stranded overhang.
22110587 two novel HLA-A0201-restricted cytotoxic T cell epitopes derived from a (-1) frameshift mutation of a coding A(8) tract within the MSH3 gene
21974800 polymorphisms in MSH3 do not contribute to cancer risk in a population of Lynch syndrome patients with colorectal cancer
21960445 Complex MSH2/MSH3 discriminates between a repair-competent and a repair-resistant loop by sensing the conformational dynamics of the junctions. MSH2/MSH3 binds, bends and dissociates from repair-competent loops to signal downstream repair.
21344488 Stress treatment of mouse cells with ethanol or hydrogen peroxide caused the re-distribution of MSH3 into nuclear bodies containing the proliferating cell nuclear antigen (PCNA), a known binding partner of MutSbeta.
21285347 Results provide novel evidence that MSH3 deficiency contributes to the cytotoxicity of platinum drugs through deficient DSB repair.
21128252 We hypothesise a model in which variants of the MSH3 gene behave as low-risk alleles that contribute to the risk of colon cancer in Lynch families, mostly with other low-risk alleles of MMR genes.
20869096 No association of tumor necrosis with expression of p53, bcl-2, and mismatch repair protein status was observed in colorectal cancers.
20845481 Nondysplastic epithelium from hamartomatous polyposis syndrome polyps harbors hMSH3 defects, which may prime neoplastic transformation.
20708618 Loss of hMSH3 corresponds with multiple tetranucleotide frameshifts. The association between EMAST and ulcerated tumors might result from increased inflammation.
20632816 Endoscopic biopsy provides equal accuracy and easier interpretation of MMRP expression immunostaining compared to surgical resection specimens.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20160730 Strong role of MutSbeta in insertion-deletions repair indicates MSH3 deficiency in tumours with low dinucleotide and no mononucleotide repeat instability.
20154325 the MutSbeta-MutLalpha interaction is mediated in part by residues ((L/I)SRFF) embedded within the MSH3 PCNA-binding motif
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19894224 methylation of hMLH1 and hMSH3 is age related and thus may play an important role in gastric carcinogenesis in the elderly.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19525234 MutSbeta displays identical biochemical and biophysical activities when interacting with a (CAG)(n) hairpin and a mismatch.[MutSbeta]
19377479 The human DNA mismatch complex MSH2-MSH3 recognizes small loops by a mechanism different from that of MSH2-MSH6 for single-base mismatches.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19115210 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18922920 Genetic instability caused by loss of MutS homologue 3 in human colorectal cancer.
18723338 Observational study of gene-disease association. (HuGE Navigator)
18701435 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18683134 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18364438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18355840 Mismatch repair gene MSH3 polymorphism is associated with the risk of sporadic prostate cancer
18355840 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17950544 Mutations at the mononucleotide repeats within the hMSH3 gene occurred in certain basal cell carcinomas, not always in association with microsatellite instability .
17676485 Alterations in TGF-betaRII, BAX, IGFIIR, caspase-5, hMSH3 and hMSH6 genes of microsatellite instability are rare in urinary bladder carcinoma and they are not associated with microsatellite instability or the presence of p53 mutations.
17494052 Observational study of gene-disease association. (HuGE Navigator)
17205513 Observational study of gene-disease association. (HuGE Navigator)
17205513 Polymorphisms in the mismatch repair gene, MSH3 is associated with colorectal cancer
16774946 Observational study of gene-disease association. (HuGE Navigator)
16552576 Plays a key role in the formation of CTG repeat expansions over successive generations in DM1 transgenic mice.
15541380 This is the first report suggesting that genetic and epigenetic alterations in the human MSH3 gene might play a significant role in the progression of bladder tumors.
14871813 MSH3 abrogation may be a predictor of metastatic disease or even favor tumor cell spread in MLH1-deficient colorectal cancers.
14625810 Observational study of genotype prevalence. (HuGE Navigator)
14510941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12014680 Frequent LOH at hMLH1, a highly variable SNP in hMSH3, and negligible coding instability occur in ovarian cancer.
11895912 Observational study of gene-disease association. (HuGE Navigator)
11756455 hMSH2-hMSH3 did not appear to bind any of the 8-oxo-G containing DNA substrates nor was there enhanced ATPase or ADP --> ATP exchange activities.

AA Sequence

MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAAAAPPAPPAPA      1 - 70
FPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSEPKKCLRTRNVSKSLEKLKEF     71 - 140
CCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNAVSSEDSKRQINQKDTTLFDLSQFGSSNTSH    141 - 210
ENLQKTASKSANKRSKSIYTPLELQYIEMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNF    211 - 280
MTASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKL    281 - 350
DDAVNVDEIMTDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSS    351 - 420
LQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDTVDIKGSQIIS    421 - 490
GIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGTTLRNLEILQNQTDMKTKGSL    491 - 560
LWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEVLHSESSVFGQIENHLRKLPDIERGLCSIYH    561 - 630
KKCSTQEFFLIVKTLYHLKSEFQAIIPAVNSHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKT    631 - 700
ELFKDLSDFPLIKKRKDEIQGVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVK    701 - 770
VGSTKAVSRFHSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKV    771 - 840
AKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMGGKSSYIKQVA    841 - 910
LITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTAEIIRKATSQSLVILDELGRG    911 - 980
TSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKNYSHQVGNYHMGFLVSEDESKLDPGAAEQVP    981 - 1050
DFVTFLYQITRGIAARSYGLNVAKLADVPGEILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQ   1051 - 1120
KWTEEFNMEETQTSLLH                                                        1121 - 1137
//

Text Mined References (90)

PMID Year Title
26617824 2015 MSH3 rs26279 polymorphism increases cancer risk: a meta-analysis.
26212458 2015 The Mismatch-Binding Factor MutS? Can Mediate ATR Activation in Response to DNA Double-Strand Breaks.
25966119 2015 Correlation of MSH3 polymorphisms with response and survival in advanced non-small cell lung cancer patients treated with first-line platinum-based chemotherapy.
25598504 2015 Association between genetic polymorphisms in DNA mismatch repair-related genes with risk and prognosis of head and neck squamous cell carcinoma.
25461668 2015 Interleukin 6 alters localization of hMSH3, leading to DNA mismatch repair defects in colorectal cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24934723 2014 Aberrant methylation of the MSH3 promoter and distal enhancer in esophageal cancer patients exposed to first-hand tobacco smoke.
23724141 2013 MSH3 mismatch repair protein regulates sensitivity to cytotoxic drugs and a histone deacetylase inhibitor in human colon carcinoma cells.
23339595 2013 DNA repair gene variants are associated with an increased risk of myelodysplastic syndromes in a Czech population.
23226332 2012 Oxidative stress induces nuclear-to-cytosol shift of hMSH3, a potential mechanism for EMAST in colorectal cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22941650 2012 MutS? and histone deacetylase complexes promote expansions of trinucleotide repeats in human cells.
22343000 2012 Down-regulation of MutS homolog 3 by hypoxia in human colorectal cancer.
22249440 2012 Aberrant protein expression and frequent allelic loss of MSH3 in colorectal cancer with low-level microsatellite instability.
22179786 2011 Mechanism of mismatch recognition revealed by human MutS? bound to unpaired DNA loops.
22110587 2011 An MSI tumor specific frameshift mutation in a coding microsatellite of MSH3 encodes for HLA-A0201-restricted CD8+ cytotoxic T cell epitopes.
21974800 2012 DNA repair gene polymorphisms and risk of early onset colorectal cancer in Lynch syndrome.
21960445 2011 Conformational trapping of mismatch recognition complex MSH2/MSH3 on repair-resistant DNA loops.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21344488 2011 The mouse mismatch repair protein, MSH3, is a nucleoplasmic protein that aggregates into denser nuclear bodies under conditions of stress.
21285347 2011 MSH3 mediates sensitization of colorectal cancer cells to cisplatin, oxaliplatin, and a poly(ADP-ribose) polymerase inhibitor.
21269460 2011 Initial characterization of the human central proteome.
21128252 2011 Association of low-risk MSH3 and MSH2 variant alleles with Lynch syndrome: probability of synergistic effects.
20869096 2010 Tumor necrosis is a new promising prognostic factor in colorectal cancer.
20845481 2011 Evidence for an hMSH3 defect in familial hamartomatous polyps.
20708618 2010 Microsatellite alterations at selected tetranucleotide repeats are associated with morphologies of colorectal neoplasias.
20632816 2010 DNA mismatch repair enzyme immunohistochemistry in colorectal cancer: a comparison of biopsy and resection material.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20160730 2010 MutSbeta exceeds MutSalpha in dinucleotide loop repair.
20154325 2010 MutLalpha and proliferating cell nuclear antigen share binding sites on MutSbeta.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19894224 2010 Aberrant methylation of DNA mismatch repair genes in elderly patients with sporadic gastric carcinoma: A comparison with younger patients.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19525234 2009 Mismatch recognition protein MutSbeta does not hijack (CAG)n hairpin repair in vitro.
19377479 2009 The nucleotide binding dynamics of human MSH2-MSH3 are lesion dependent.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19115210 2009 Common germline variation in mismatch repair genes and survival after a diagnosis of colorectal cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18922920 2008 Genetic instability caused by loss of MutS homologue 3 in human colorectal cancer.
18723338 2008 Mismatch repair gene polymorphisms and survival in invasive ovarian cancer patients.
18701435 2008 Polygenic model of DNA repair genetic polymorphisms in human breast cancer risk.
18683134 2008 [Association of genetic polymorphisms and haplotypes in hMLH1 and hMSH3 gene with the risk of papillary thyroid carcinoma].
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18364438 2008 Common variants in mismatch repair genes and risk of colorectal cancer.
18355840 2008 Mismatch repair gene MSH3 polymorphism is associated with the risk of sporadic prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17950544 2007 Mutations of microsatellite instability target genes in sporadic basal cell carcinomas.
17715146 2007 Physical and functional interactions between Werner syndrome helicase and mismatch-repair initiation factors.
17676485 2007 TGF-betaRII, BAX, IGFIIR, caspase-5, hMSH3 and hMSH6 alterations are not associated with microsatellite instability or p53 mutations in invasive urothelial carcinoma of the urinary bladder.
17494052 2007 Polymorphism discovery in 62 DNA repair genes and haplotype associations with risks for lung and head and neck cancers.
17456004 2007 Selective translational repression of truncated proteins from frameshift mutation-derived mRNAs in tumors.
17205513 2007 Mismatch repair polymorphisms and the risk of colorectal cancer.
16774946 2006 Common variants in mismatch repair genes and risk of invasive ovarian cancer.
16552576 2006 Msh3 is a limiting factor in the formation of intergenerational CTG expansions in DM1 transgenic mice.
16388310 2006 Transcription promotes contraction of CAG repeat tracts in human cells.
15541380 2004 Inactivation of the hMSH3 mismatch repair gene in bladder cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14871813 2004 Loss of MSH3 protein expression is frequent in MLH1-deficient colorectal cancer and is associated with disease progression.
14657349 2003 MSH2 and ATR form a signaling module and regulate two branches of the damage response to DNA methylation.
14625810 2003 Variable continental distribution of polymorphisms in the coding regions of DNA-repair genes.
14510941 2003 Role of DNA mismatch repair genetic polymorphisms in the risk of childhood acute lymphoblastic leukaemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12014680 Frequent LOH at hMLH1, a highly variable SNP in hMSH3, and negligible coding instability in ovarian cancer.
11920679 2002 DNA mismatch repair and mutation avoidance pathways.
11895912 2002 Polymorphisms in genes encoding drugs and xenobiotic metabolizing enzymes, DNA repair enzymes, and response to treatment of childhood acute lymphoblastic leukemia.
11809883 2002 hMutSalpha forms an ATP-dependent complex with hMutLalpha and hMutLbeta on DNA.
11756455 2002 Activation of human MutS homologs by 8-oxo-guanine DNA damage.
11427529 2001 The interaction of DNA mismatch repair proteins with human exonuclease I.
11005803 2000 Functional interaction of proliferating cell nuclear antigen with MSH2-MSH6 and MSH2-MSH3 complexes.
10944853 2000 Association between single nucleotide polymorphisms in the hMSH3 gene and sporadic colon cancer with microsatellite instability.
10871409 2000 Multiple mutations and frameshifts are the hallmark of defective hPMS2 in pZ189-transfected human tumor cells.
9774676 1998 Interactions of human hMSH2 with hMSH3 and hMSH2 with hMSH6: examination of mutations found in hereditary nonpolyposis colorectal cancer.
8942985 1996 hMSH2 forms specific mispair-binding complexes with hMSH3 and hMSH6.
8851770 1995 Nine-bp repeat polymorphism in exon 1 of the hMSH3 gene.
8838312 1996 Genomic organization and expression of the human MSH3 gene.
8782829 1996 Mutation of MSH3 in endometrial cancer and evidence for its functional role in heteroduplex repair.
8029024 1994 Identification of two initiator elements in the bidirectional promoter of the human dihydrofolate reductase and mismatch repair protein 1 genes.
6323448 1984 The functional human dihydrofolate reductase gene.
2722860 1989 Isolation and characterization of cDNA clones derived from the divergently transcribed gene in the region upstream from the human dihydrofolate reductase gene.