Property Summary

NCBI Gene PubMed Count 13
PubMed Score 144.87
PubTator Score 141.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 4.4e-03
cystic fibrosis -1.713 3.3e-05
atypical teratoid / rhabdoid tumor -1.100 5.3e-04
tuberculosis -2.000 2.3e-08

Synonym

Accession O60682 O75946 Q53XZ2 Q9BRE7
Symbols ABF1
MYOR
ABF-1
bHLHa22

Gene

MSC

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
25070843 results demonstrate that ABF-1 facilitates formation of memory B cells but prevents plasma cell differentiation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
18368067 ABF-1 is frequently silenced by promoter methylation in follicular lymphoma, diffuse large B-cell lymphoma and Burkitt's lymphoma.
15052269 role in repressing lymphotoxin alpha

AA Sequence

MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGC      1 - 70
KRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPD     71 - 140
TKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANRLCGTTA        141 - 206
//

Text Mined References (13)

PMID Year Title
25070843 2014 Transcription factor ABF-1 suppresses plasma cell differentiation but facilitates memory B cell formation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
18368067 2008 ABF-1 is frequently silenced by promoter methylation in follicular lymphoma, diffuse large B-cell lymphoma and Burkitt's lymphoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15052269 2004 Allele-specific repression of lymphotoxin-alpha by activated B cell factor-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11560778 2001 Characterization of a basic helix-loop-helix protein, ABF-1: nuclear localization, transcriptional properties, and interaction with Id-2.
10198176 1999 Assignment of the human helix-loop-helix transcription factor gene musculin/activated B-cell factor-1 (MSC) to chromosome 8q21 and its mouse homologue (Msc) to the proximal region of chromosome 1.
9767165 1998 musculin: a murine basic helix-loop-helix transcription factor gene expressed in embryonic skeletal muscle.
9584154 1998 Characterization of ABF-1, a novel basic helix-loop-helix transcription factor expressed in activated B lymphocytes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.