Property Summary

NCBI Gene PubMed Count 14
PubMed Score 156.41
PubTator Score 141.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 2.3e-08
cystic fibrosis 1696 3.3e-05
atypical teratoid / rhabdoid tumor 5112 5.3e-04
ependymoma 4679 4.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Pain agnosia 104 4.258 2.1
Hodgkin's lymphoma 15 3.01 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 5.3e-04
cystic fibrosis -1.713 3.3e-05
ependymoma -1.100 4.4e-03
tuberculosis -2.000 2.3e-08

Gene RIF (5)

AA Sequence

MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGC      1 - 70
KRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPD     71 - 140
TKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANRLCGTTA        141 - 206
//

Text Mined References (14)

PMID Year Title