Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.77
PubTator Score 0.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.0e-04
Disease Target Count Z-score Confidence
Brain glioma 7 3.714 1.9
Leigh disease 100 3.653 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 2.0e-04

Synonym

Accession P82930 Q9BVI7 MRP-S34
Symbols MRPS12
COXPD32
MRP-S12
MRP-S34

Gene

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MARKKVRPRLIAELARRVRALREQLNRPRDSQLYAVDYETLTRPFSGRRLPVRAWADVRRESRLLQLLGR      1 - 70
LPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGKAWGILTFKGKTESEAREIEHVMYHDWR     71 - 140
LVPKHEEEAFTAFTPAPEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDK    141 - 210
GRAKGTPV                                                                  211 - 218
//

Text Mined References (13)

PMID Year Title