Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.10
PubTator Score 0.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (1)

AA Sequence

MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPS      1 - 70
TLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYE     71 - 140
EHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALC    141 - 210
IRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ                           211 - 257
//

Text Mined References (15)

PMID Year Title