Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.03
PubTator Score 11.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 3.6e-03
atypical teratoid / rhabdoid tumor -1.100 7.1e-05
Breast cancer 1.100 1.3e-04
glioblastoma 1.500 1.1e-02
invasive ductal carcinoma 1.100 2.0e-03
lung adenocarcinoma 1.012 2.5e-03
medulloblastoma, large-cell -1.100 6.7e-04
non-small cell lung cancer 1.298 3.2e-18
osteosarcoma 1.811 3.0e-03
ovarian cancer 1.300 1.8e-03
pancreatic ductal adenocarcinoma liver m... -1.984 2.1e-02

Gene RIF (5)

AA Sequence

MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKP      1 - 70
KKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK       71 - 138
//

Text Mined References (20)

PMID Year Title